UniProt ID | TOM40_MOUSE | |
---|---|---|
UniProt AC | Q9QYA2 | |
Protein Name | Mitochondrial import receptor subunit TOM40 homolog | |
Gene Name | Tomm40 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 361 | |
Subcellular Localization |
Mitochondrion outer membrane Multi-pass membrane protein . |
|
Protein Description | Channel-forming protein essential for import of protein precursors into mitochondria.. | |
Protein Sequence | MGNVLAASSPPAGPPPPPTPSLVGLPPPPPSPPGFTLPPLGGGLGTGSSTGRGSERTPGAAASGAAAASEDGSCGCLPNPGTFEECHRKCKELFPVQMEGVKLTVNKGLSNRFQVTHTVALGTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLSPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSASFGYQLDLPKANFLFKGSVNSNWIVGATLEKKLPPLPLTLSLCAFLNHRKNKFLCGFGLTIG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
69 | Phosphorylation | ASGAAAASEDGSCGC CCCCCCCCCCCCCCC | 31.34 | - | |
76 | S-palmitoylation | SEDGSCGCLPNPGTF CCCCCCCCCCCCCCH | 7.19 | 28680068 | |
89 | Ubiquitination | TFEECHRKCKELFPV CHHHHHHHHHHHCCC | 26.45 | - | |
91 | Ubiquitination | EECHRKCKELFPVQM HHHHHHHHHHCCCCE | 61.56 | 22790023 | |
102 | Ubiquitination | PVQMEGVKLTVNKGL CCCEEEEEEEECCCC | 49.66 | 22790023 | |
107 | Ubiquitination | GVKLTVNKGLSNRFQ EEEEEECCCCCCCCE | 57.82 | 22790023 | |
142 | Phosphorylation | YVGTKQLSPTEAFPV EEECCCCCCCCCCCE | 27.55 | 23984901 | |
144 | Phosphorylation | GTKQLSPTEAFPVLV ECCCCCCCCCCCEEE | 36.25 | 23984901 | |
157 | Phosphorylation | LVGDMDNSGSLNAQV EEECCCCCCCCCHHH | 26.04 | 26745281 | |
159 | Phosphorylation | GDMDNSGSLNAQVIH ECCCCCCCCCHHHHH | 20.47 | 26745281 | |
169 | Phosphorylation | AQVIHQLSPGLRSKM HHHHHHHCHHHHHCE | 15.45 | 29514104 | |
175 | Ubiquitination | LSPGLRSKMAIQTQQ HCHHHHHCEEEEECH | 26.39 | 22790023 | |
183 | Phosphorylation | MAIQTQQSKFVNWQV EEEEECHHHCCCEEE | 20.46 | 29514104 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TOM40_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TOM40_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TOM40_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TOM40_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...