| UniProt ID | TOM40_MOUSE | |
|---|---|---|
| UniProt AC | Q9QYA2 | |
| Protein Name | Mitochondrial import receptor subunit TOM40 homolog | |
| Gene Name | Tomm40 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 361 | |
| Subcellular Localization |
Mitochondrion outer membrane Multi-pass membrane protein . |
|
| Protein Description | Channel-forming protein essential for import of protein precursors into mitochondria.. | |
| Protein Sequence | MGNVLAASSPPAGPPPPPTPSLVGLPPPPPSPPGFTLPPLGGGLGTGSSTGRGSERTPGAAASGAAAASEDGSCGCLPNPGTFEECHRKCKELFPVQMEGVKLTVNKGLSNRFQVTHTVALGTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLSPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSASFGYQLDLPKANFLFKGSVNSNWIVGATLEKKLPPLPLTLSLCAFLNHRKNKFLCGFGLTIG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 69 | Phosphorylation | ASGAAAASEDGSCGC CCCCCCCCCCCCCCC | 31.34 | - | |
| 76 | S-palmitoylation | SEDGSCGCLPNPGTF CCCCCCCCCCCCCCH | 7.19 | 28680068 | |
| 89 | Ubiquitination | TFEECHRKCKELFPV CHHHHHHHHHHHCCC | 26.45 | - | |
| 91 | Ubiquitination | EECHRKCKELFPVQM HHHHHHHHHHCCCCE | 61.56 | 22790023 | |
| 102 | Ubiquitination | PVQMEGVKLTVNKGL CCCEEEEEEEECCCC | 49.66 | 22790023 | |
| 107 | Ubiquitination | GVKLTVNKGLSNRFQ EEEEEECCCCCCCCE | 57.82 | 22790023 | |
| 142 | Phosphorylation | YVGTKQLSPTEAFPV EEECCCCCCCCCCCE | 27.55 | 23984901 | |
| 144 | Phosphorylation | GTKQLSPTEAFPVLV ECCCCCCCCCCCEEE | 36.25 | 23984901 | |
| 157 | Phosphorylation | LVGDMDNSGSLNAQV EEECCCCCCCCCHHH | 26.04 | 26745281 | |
| 159 | Phosphorylation | GDMDNSGSLNAQVIH ECCCCCCCCCHHHHH | 20.47 | 26745281 | |
| 169 | Phosphorylation | AQVIHQLSPGLRSKM HHHHHHHCHHHHHCE | 15.45 | 29514104 | |
| 175 | Ubiquitination | LSPGLRSKMAIQTQQ HCHHHHHCEEEEECH | 26.39 | 22790023 | |
| 183 | Phosphorylation | MAIQTQQSKFVNWQV EEEEECHHHCCCEEE | 20.46 | 29514104 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TOM40_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TOM40_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TOM40_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TOM40_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...