dbPTM

TOM22_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TOM22_SCHPO
UniProt AC	O13813
Protein Name	Mitochondrial import receptor subunit tom22
Gene Name	tom22
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	144
Subcellular Localization	Mitochondrion outer membrane Single-pass type II membrane protein.
Protein Description	Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with tom20 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore. Docks tom20 and tom70 for interaction with the general tom40 import pore (GIP) complex. May regulate the TOM machinery organization, stability and channel gating (By similarity)..
Protein Sequence	MVKLEEVVDETEVQNEQQTVIEKDQYIYAQEDVEESDSDESDFEGLEEETIIDRIAALKEIVPVTWRVKIADGAKTATTGLSKLAQFGGKSMWVISTSALLLGVPFMMSLEEEAQLTEYEKQIKDQRGANEVIAPGATSGALPQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	EVQNEQQTVIEKDQY HCCCCCEEEEEHHHE	24.12	24763107
36	Phosphorylation	AQEDVEESDSDESDF EECCCCCCCCCCCCC	28.98	21712547
38	Phosphorylation	EDVEESDSDESDFEG CCCCCCCCCCCCCCC	53.18	21712547
41	Phosphorylation	EESDSDESDFEGLEE CCCCCCCCCCCCCCH	53.22	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TOM22_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TOM22_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TOM22_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TOM22_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TOM22_SCHPO

Related Literatures of Post-Translational Modification