TOM22_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TOM22_MOUSE
• UniProt AC: Q9CPQ3
• Protein Name: Mitochondrial import receptor subunit TOM22 homolog
• Gene Name: Tomm22
• Organism: Mus musculus (Mouse).
• Sequence Length: 142
• Subcellular Localization: Mitochondrion outer membrane; Single-pass membrane protein.
• Protein Description: Central receptor component of the translocase of the outer membrane of mitochondria (TOM complex) responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with the peripheral receptor TOM20 functions as the transit peptide receptor and facilitates the movement of preproteins into the translocation pore (By similarity)..
• Protein Sequence: MAAAVAAAGAGEPLSPEELLPKAEAEKAEEELEEDDDDELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPPLPGKM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAAVAAAG ------CHHHHHHCC	12.25	-
15	Phosphorylation	AGAGEPLSPEELLPK CCCCCCCCHHHHHHH	40.77	26824392
27	Ubiquitination	LPKAEAEKAEEELEE HHHHHHHHHHHHHHH	69.05	-
43	Phosphorylation	DDDELDETLSERLWG CCHHHHHHHHHHHHH	34.94	30635358
45	Phosphorylation	DELDETLSERLWGLT HHHHHHHHHHHHHHH	28.26	21082442
125	Phosphorylation	QILLGPNTGLSGGMP HHHHCCCCCCCCCCC	42.50	28059163
128	Phosphorylation	LGPNTGLSGGMPGAL HCCCCCCCCCCCCCC	34.35	28059163

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TOM22_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TOM22_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TOM22_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of TOM22_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.