UniProt ID | TOM1_ARATH | |
---|---|---|
UniProt AC | Q9FEG2 | |
Protein Name | Tobamovirus multiplication protein 1 | |
Gene Name | TOM1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 291 | |
Subcellular Localization |
Vacuole membrane Multi-pass membrane protein . |
|
Protein Description | Necessary for the efficient intracellular multiplication of tobamoviruses, probably being a membrane anchor promoting the formation of the replication complex.. | |
Protein Sequence | MTDSGLMMPAEIAGILTTAITSWWDDVNESTQWQDGIFFALCGAYALVSAVALVQLIRIQMRVPEYGWTTQKVFHLMNFVVNGVRAVLFGFHMQVFLVHPKALCWVLLDLPGLLFFSAYTLLVLFWAEIYHQARSLPTDKLRITYISVNVAVYLAQIGIWAYIWVHDNSTVELVGKIFIAVVSFIAALGFLLYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCVVVAVSAFDKDLTLDVLDHPVLNLIYYMVVEVLPSALVLFILRKLPPKRVSAQYHPIQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TOM1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TOM1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TOM1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TOM2A_ARATH | TOM2A | physical | 12514139 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...