UniProt ID | TNPO1_ARATH | |
---|---|---|
UniProt AC | Q8H0U4 | |
Protein Name | Transportin-1 | |
Gene Name | TRN1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 891 | |
Subcellular Localization | Cytoplasm. Nucleus, nucleoplasm . Shuttles continuously between the nucleus and the cytoplasm. | |
Protein Description | Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Involved in nuclear import of M9-containing proteins. In vitro, binds directly to the M9 region of the glycine-rich RNA-binding RBG7 and mediates its nuclear import.. | |
Protein Sequence | MAATAVVWQPRDDGLAEICSLLEQQISPSSVVDKSQIWKQLQHFSQFPDFNNYLVFILVRAEGKSVEVRQAAGLLLKNNLRGAYPSMTQENQKYIKSELLPCLGAADRNIRTTVGTIISVIVNIEGVSGWHELLPALVTCLDSNDLNHMDGAMDALSKICEDIPHVLDTEVPGLAERPINIFLPRLLQFFQSPHASLRKLALGSVNQYIIIMPAALYNSLDKYLQGLFVLANDPVPEVRKLVCAAFVHLTEVLPSSIEPHLRNVMEYMLQVNRDPDEEVSLEACEFWSAYCDAQLPPENLKEFLPRLIPVLLENMAYADDDESLLDAEEDESQPDRDQDLKPRFHTSRLHGSEDFDDDDDDSFNVWNLRKCSAAAIDVLSNVFGDEILPALMPLIQKNLSASGDEAWKQREAAVLALGAIAEGCMNGLYPHLSEIVAFLLPLLDDKFPLIRSISCWTLSRFGKYLIQESGNPKGYEQFEKVLMGLLRRLLDTNKRVQEAACSAFATVEEDAAEELVPHLGVILQHLMCAFGKYQRRNLRIVYDAIGTLADSVREELNKPAYLEILMPPLVAKWQQLSNSDKDLFPLLECFTSISQALGVGFAPFAQPVFQRCMDIIQLQQLAKVNPASAGAQYDREFIVCSLDLLSGLAEGLGSGIESLVQQSNLRDLLLNCCIDEAADVRQSAFALMGDLARVFPVYLQPRLLDFLEIASQQLSANLNRENLSVANNACWAIGELAVKVRQEVSPIVAKVVSSLGLILQHGEGVNKALVENSAITLGRLAWIRPDLVAPHMDHFMKPWCMALSMVRDDIEKEDAFRGLCAVVKVNPSGGVSSLVFICQAIASWHEIRSEDVQTEVSQVLNGYKHMLGNSWAECLSALDPPVKERLARYQV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAATAVVWQ ------CCCEEEEEC | 22223895 | ||
27 | Phosphorylation | SLLEQQISPSSVVDK HHHHHCCCCHHHCCH | 23776212 | ||
29 | Phosphorylation | LEQQISPSSVVDKSQ HHHCCCCHHHCCHHH | 23776212 | ||
30 | Phosphorylation | EQQISPSSVVDKSQI HHCCCCHHHCCHHHH | 23776212 | ||
352 | Phosphorylation | HTSRLHGSEDFDDDD CHHHCCCCCCCCCCC | 23776212 | ||
362 | Phosphorylation | FDDDDDDSFNVWNLR CCCCCCCCCCHHHHH | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNPO1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNPO1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNPO1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...