UniProt ID | TNNC3_DROME | |
---|---|---|
UniProt AC | P47949 | |
Protein Name | Troponin C, isoform 3 | |
Gene Name | TpnC73F | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 155 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSSVDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFMEMMTGE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSVDEDLT ------CCCCCCCCC | 38.78 | 27794539 | |
3 | Phosphorylation | -----MSSVDEDLTP -----CCCCCCCCCH | 32.08 | 27794539 | |
22 | Phosphorylation | VLQKAFNSFDHQKTG HHHHHHHCCCCCCCC | 26.12 | 27794539 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNNC3_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNNC3_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNNC3_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TNNC3_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...