UniProt ID | TNNC2_MOUSE | |
---|---|---|
UniProt AC | P20801 | |
Protein Name | Troponin C, skeletal muscle | |
Gene Name | Tnnc2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 160 | |
Subcellular Localization | ||
Protein Description | Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.. | |
Protein Sequence | MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEHVTEEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MTDQQAEAR ------CCHHHHHHH | 42.38 | - | |
13 | Phosphorylation | AEARSYLSEEMIAEF HHHHHHCCHHHHHHH | 24.23 | 28464351 | |
36 | Phosphorylation | ADGGGDISVKELGTV CCCCCCEEHHHHHHH | 31.69 | - | |
38 | Ubiquitination | GGGDISVKELGTVMR CCCCEEHHHHHHHHH | 40.19 | - | |
50 | Phosphorylation | VMRMLGQTPTKEELD HHHHHCCCCCHHHHH | 31.00 | 28542873 | |
52 | Phosphorylation | RMLGQTPTKEELDAI HHHCCCCCHHHHHHH | 55.25 | 25521595 | |
89 | Ubiquitination | RQMKEDAKGKSEEEL HHHHHHHCCCCHHHH | 78.26 | - | |
91 | Ubiquitination | MKEDAKGKSEEELAE HHHHHCCCCHHHHHH | 54.72 | - | |
92 | Phosphorylation | KEDAKGKSEEELAEC HHHHCCCCHHHHHHH | 59.93 | 22210690 | |
134 | Phosphorylation | VTEEEIESLMKDGDK CCHHHHHHHHHHCCC | 39.15 | 22210690 | |
137 | Ubiquitination | EEIESLMKDGDKNND HHHHHHHHHCCCCCC | 64.95 | - | |
141 | Ubiquitination | SLMKDGDKNNDGRID HHHHHCCCCCCCCCC | 64.28 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNNC2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNNC2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNNC2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TNNC2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...