| UniProt ID | TNNC2_HUMAN | |
|---|---|---|
| UniProt AC | P02585 | |
| Protein Name | Troponin C, skeletal muscle | |
| Gene Name | TNNC2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 160 | |
| Subcellular Localization | ||
| Protein Description | Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.. | |
| Protein Sequence | MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MTDQQAEAR ------CCHHHHHHH | 42.38 | 978749 | |
| 36 | Phosphorylation | ADGGGDISVKELGTV CCCCCCEEHHHHHHH | 31.69 | 24719451 | |
| 38 | Ubiquitination | GGGDISVKELGTVMR CCCCEEHHHHHHHHH | 40.19 | - | |
| 42 | Phosphorylation | ISVKELGTVMRMLGQ EEHHHHHHHHHHHCC | 24.61 | 26437602 | |
| 45 | Methylation | KELGTVMRMLGQTPT HHHHHHHHHHCCCCC | 16.91 | - | |
| 50 | Phosphorylation | VMRMLGQTPTKEELD HHHHHCCCCCHHHHH | 31.00 | 24719451 | |
| 92 | Phosphorylation | KEDAKGKSEEELAEC HHHHCCCCHHHHHHH | 59.93 | 26437602 | |
| 134 | Phosphorylation | VTDEEIESLMKDGDK CCHHHHHHHHHHCCC | 39.15 | 26437602 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNNC2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNNC2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNNC2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TNNI3_HUMAN | TNNI3 | physical | 25416956 |
| Kegg Disease | |
|---|---|
| There are no disease associations of PTM sites. | |
| OMIM Disease | |
| There are no disease associations of PTM sites. | |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB01023 | Felodipine |
loading...