UniProt ID | TNNC2_HUMAN | |
---|---|---|
UniProt AC | P02585 | |
Protein Name | Troponin C, skeletal muscle | |
Gene Name | TNNC2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 160 | |
Subcellular Localization | ||
Protein Description | Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.. | |
Protein Sequence | MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MTDQQAEAR ------CCHHHHHHH | 42.38 | 978749 | |
36 | Phosphorylation | ADGGGDISVKELGTV CCCCCCEEHHHHHHH | 31.69 | 24719451 | |
38 | Ubiquitination | GGGDISVKELGTVMR CCCCEEHHHHHHHHH | 40.19 | - | |
42 | Phosphorylation | ISVKELGTVMRMLGQ EEHHHHHHHHHHHCC | 24.61 | 26437602 | |
45 | Methylation | KELGTVMRMLGQTPT HHHHHHHHHHCCCCC | 16.91 | - | |
50 | Phosphorylation | VMRMLGQTPTKEELD HHHHHCCCCCHHHHH | 31.00 | 24719451 | |
92 | Phosphorylation | KEDAKGKSEEELAEC HHHHCCCCHHHHHHH | 59.93 | 26437602 | |
134 | Phosphorylation | VTDEEIESLMKDGDK CCHHHHHHHHHHCCC | 39.15 | 26437602 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNNC2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNNC2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNNC2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TNNI3_HUMAN | TNNI3 | physical | 25416956 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB01023 | Felodipine |
loading...