dbPTM

TMX1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TMX1_MOUSE
UniProt AC	Q8VBT0
Protein Name	Thioredoxin-related transmembrane protein 1
Gene Name	Tmx1
Organism	Mus musculus (Mouse).
Sequence Length	278
Subcellular Localization	Membrane Single-pass type I membrane protein . Endoplasmic reticulum membrane Single-pass type I membrane protein . Predominantly found in the endoplasmic reticulum..
Protein Description	May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions..
Protein Sequence	MAHLGRLMVPLAALVLLLWAVPGAHGRRNNVRVLTDENWTSLLEGEWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVKVAKVDVTEQTGLSGRFIITALPSIYHCKDGEFRRYVGPRTKKDFINFVSDKEWKNIEPISSWFGPSSVLMTMMSALFQLSVYIRTSHSYFVHDLGIPAWGSYLVFAFATVLSGLLLGLCMIFVADCLCPSKRRKPQQQYAKKTSPEFSQPLKKVEEEQEADEEDVSEEEAEDREGASKATSQSSIRQRCVGLPSATDTS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
82	Ubiquitination	DLEVKVAKVDVTEQT CCEEEEEEEECCCCC	41.79	22790023
106	S-palmitoylation	ALPSIYHCKDGEFRR ECCEEEECCCCCCHH	2.11	28526873
222	Phosphorylation	QQQYAKKTSPEFSQP HHHHHHHCCHHHCHH	49.13	25521595
223	Phosphorylation	QQYAKKTSPEFSQPL HHHHHHCCHHHCHHH	31.17	26824392
227	Phosphorylation	KKTSPEFSQPLKKVE HHCCHHHCHHHHHHH	29.26	29514104
231	Ubiquitination	PEFSQPLKKVEEEQE HHHCHHHHHHHHHHH	62.55	27667366
245	Phosphorylation	EADEEDVSEEEAEDR HCCCCCCCHHHHHHH	52.17	27087446
256	Phosphorylation	AEDREGASKATSQSS HHHHHHHCHHCCHHH	33.41	27742792
259	Phosphorylation	REGASKATSQSSIRQ HHHHCHHCCHHHHHH	30.91	28066266
260	Phosphorylation	EGASKATSQSSIRQR HHHCHHCCHHHHHHH	32.69	28066266
262	Phosphorylation	ASKATSQSSIRQRCV HCHHCCHHHHHHHHC	27.74	25266776
263	Phosphorylation	SKATSQSSIRQRCVG CHHCCHHHHHHHHCC	17.72	30352176
273	Phosphorylation	QRCVGLPSATDTS-- HHHCCCCCCCCCC--	49.17	25619855
275	Phosphorylation	CVGLPSATDTS---- HCCCCCCCCCC----	44.11	25619855
277	Phosphorylation	GLPSATDTS------ CCCCCCCCC------	31.79	25521595
278	Phosphorylation	LPSATDTS------- CCCCCCCC-------	40.82	27087446

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TMX1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TMX1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TMX1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TMX1_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TMX1_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large scale localization of protein phosphorylation by use ofelectron capture dissociation mass spectrometry."; Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.; Mol. Cell. Proteomics 8:904-912(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, AND MASSSPECTROMETRY.	19131326 [Abstract]
"The phagosomal proteome in interferon-gamma-activated macrophages."; Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,Thibault P.; Immunity 30:143-154(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, AND MASSSPECTROMETRY.	19144319 [Abstract]
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, AND MASSSPECTROMETRY.	19367708 [Abstract]
"Specific phosphopeptide enrichment with immobilized titanium ionaffinity chromatography adsorbent for phosphoproteome analysis."; Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H.; J. Proteome Res. 7:3957-3967(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, AND MASSSPECTROMETRY.	18630941 [Abstract]
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-256, AND MASSSPECTROMETRY.	17242355 [Abstract]
"Mitochondrial phosphoproteome revealed by an improved IMAC method andMS/MS/MS."; Lee J., Xu Y., Chen Y., Sprung R., Kim S.C., Xie S., Zhao Y.; Mol. Cell. Proteomics 6:669-676(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, AND MASSSPECTROMETRY.	17208939 [Abstract]
"Qualitative and quantitative analyses of protein phosphorylation innaive and stimulated mouse synaptosomal preparations."; Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,Gerrits B., Panse C., Schlapbach R., Mansuy I.M.; Mol. Cell. Proteomics 6:283-293(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, AND MASSSPECTROMETRY.	17114649 [Abstract]
"Protein phosphorylation and expression profiling by Yin-yangmultidimensional liquid chromatography (Yin-yang MDLC) massspectrometry."; Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R.; J. Proteome Res. 6:250-262(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, AND MASSSPECTROMETRY.	17203969 [Abstract]