TMUB1_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TMUB1_RAT
• UniProt AC: Q53AQ4
• Protein Name: Transmembrane and ubiquitin-like domain-containing protein 1
• Gene Name: Tmub1
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 245
• Subcellular Localization: Membrane ; Multi-pass membrane protein . Cell junction, synapse, postsynaptic cell membrane . Recycling endosome . Cytoplasm . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Nucleus . Nucleus, nucleolus . Localized to neuronal s
• Protein Description: Involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR (By similarity). Involved in positive regulation of AMPA-selective glutamate receptor GRIA2 recycling to the cell surface. [PubMed: 18665261 Acts as negative regulator of hepatocyte growth during regeneration]
• Protein Sequence: MALIEGVGDEVTVLFSVLACLLVLALAWVSTHTTESTDPLPQSSGTTTPAQPSEAMTAIDSIREEAPGAESPSLRHRGPSAQPEPEAGVTASTPPDSPQEPLLLRLKFLNDSEQVARAWPQDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPHPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
71	Phosphorylation	EEAPGAESPSLRHRG HHCCCCCCCCCCCCC	21.18	29779826
73	Phosphorylation	APGAESPSLRHRGPS CCCCCCCCCCCCCCC	47.52	22673903
80	Phosphorylation	SLRHRGPSAQPEPEA CCCCCCCCCCCCCCC	42.22	25575281
90	Phosphorylation	PEPEAGVTASTPPDS CCCCCCCCCCCCCCC	17.61	25575281
92	Phosphorylation	PEAGVTASTPPDSPQ CCCCCCCCCCCCCCC	31.89	25575281
93	Phosphorylation	EAGVTASTPPDSPQE CCCCCCCCCCCCCCC	36.05	25575281
97	Phosphorylation	TASTPPDSPQEPLLL CCCCCCCCCCCCEEE	33.97	25575281
107	Ubiquitination	EPLLLRLKFLNDSEQ CCEEEEEEECCCHHH	41.18	-
126	Phosphorylation	WPQDTIGSLKRTQFP CCCCCHHCCCCCCCC	27.20	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TMUB1_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TMUB1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TMUB1_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of TMUB1_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.