UniProt ID | TMPS2_HUMAN | |
---|---|---|
UniProt AC | O15393 | |
Protein Name | Transmembrane protease serine 2 | |
Gene Name | TMPRSS2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 492 | |
Subcellular Localization |
Cell membrane Single-pass type II membrane protein . Transmembrane protease serine 2 catalytic chain: Secreted . Activated by cleavage and secreted. |
|
Protein Description | Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized and maintained in precursor intermediate folding states and proteolysis permits the refolding and energy release required to create stable virus-cell linkages and membrane coalescence. Facilitates human SARS coronavirus (SARS-CoV) infection via two independent mechanisms, proteolytic cleavage of ACE2, which might promote viral uptake, and cleavage of coronavirus spike glycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activates the spike glycoproteins of human coronavirus 229E (HCoV-229E) and human coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0 of Sendai virus (SeV), human metapneumovirus (HMPV), human parainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9); involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity.. | |
Protein Sequence | MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
26 | Phosphorylation | GYQPENPYPAQPTVV CCCCCCCCCCCCCEE | 23.84 | 27642862 | |
44 | Phosphorylation | YEVHPAQYYPSPVPQ EEECHHHCCCCCCCC | 21.32 | - | |
45 | Phosphorylation | EVHPAQYYPSPVPQY EECHHHCCCCCCCCC | 5.78 | - | |
52 | Phosphorylation | YPSPVPQYAPRVLTQ CCCCCCCCCCCCCCC | 16.71 | 21253578 | |
58 | Phosphorylation | QYAPRVLTQASNPVV CCCCCCCCCCCCCEE | 21.16 | 27499020 | |
61 | Phosphorylation | PRVLTQASNPVVCTQ CCCCCCCCCCEEECC | 31.67 | 27251275 | |
95 | Phosphorylation | TLTLGTFLVGAALAA ECCHHHHHHHHHHHH | 3.31 | 27251275 | |
98 | Phosphorylation | LGTFLVGAALAAGLL HHHHHHHHHHHHHHH | 7.57 | 27251275 | |
195 | Phosphorylation | MGYKNNFYSSQGIVD HCCCCCCCCCCCEEC | 14.99 | 30576142 | |
206 | Phosphorylation | GIVDDSGSTSFMKLN CEECCCCCCCEEEEC | 25.48 | 30576142 | |
208 | Phosphorylation | VDDSGSTSFMKLNTS ECCCCCCCEEEECCC | 25.66 | 30576142 | |
213 | N-linked_Glycosylation | STSFMKLNTSAGNVD CCCEEEECCCCCCCC | 26.86 | UniProtKB CARBOHYD | |
222 | Phosphorylation | SAGNVDIYKKLYHSD CCCCCCHHHHHHCCC | 9.52 | 28509920 | |
249 | N-linked_Glycosylation | IACGVNLNSSRQSRI EECCCCCCCCCCCEE | 32.51 | UniProtKB CARBOHYD | |
341 | Phosphorylation | HPNYDSKTKNNDIAL CCCCCCCCCCCCEEE | 42.85 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMPS2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMPS2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMPS2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TMPS2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00024 | Prostate cancer | |||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...