dbPTM

TMOD2_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TMOD2_RAT
UniProt AC	P70566
Protein Name	Tropomodulin-2
Gene Name	Tmod2
Organism	Rattus norvegicus (Rat).
Sequence Length	351
Subcellular Localization	Cytoplasm, cytoskeleton.
Protein Description	Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton (By similarity)..
Protein Sequence	MALPFQKGLEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESATLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPVETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETTNGQGRKGPVRNVVKGEKAKPVFEEPPNPTNVEASLQQMKANDPSLQEVNLNNIKNIPIPTLKEFAKALETNTHVRKFSLAATRSNDPVALAFAEMLKVNKTLKSLNVESNFITGAGILALVEALRENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEGDRR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	DELLGKLSEEELKQL HHHHHHCCHHHHHHH	46.58	30240740
81	Ubiquitination	EKEALEQKDREDFVP HHHHHHHCCHHHCCC	49.75	-
127	Phosphorylation	EEALASASDTELYDL HHHHHCCCCHHHHHH	42.44	22673903
129	Phosphorylation	ALASASDTELYDLAA HHHCCCCHHHHHHHH	25.95	22673903
232	Phosphorylation	NTHVRKFSLAATRSN CHHHHEEEHHHCCCC	21.82	28432305

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TMOD2_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TMOD2_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TMOD2_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TMOD2_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TMOD2_RAT

Related Literatures of Post-Translational Modification