UniProt ID | TMOD2_MOUSE | |
---|---|---|
UniProt AC | Q9JKK7 | |
Protein Name | Tropomodulin-2 | |
Gene Name | Tmod2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 351 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton (By similarity).. | |
Protein Sequence | MALPFQKGLEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESATLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPVETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETTNGEGRKGPVRNVVKGEKAKPVFEEPPNPTNVEASLQQMKANDPSLQEVNLNNIKNIPIPTLKEFAKSLETNTHVKKFSLAATRSNDPVALAFAEMLKVNKTLKSLNVESNFITGTGILALVEALRENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEGDRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Ubiquitination | DEDELLGKLSEEELK CHHHHHHHCCHHHHH | 49.13 | 22790023 | |
25 | Phosphorylation | DELLGKLSEEELKQL HHHHHHCCHHHHHHH | 46.58 | 25521595 | |
81 | Ubiquitination | EKEALEQKDREDFVP HHHHHHHCCHHHCCC | 49.75 | 22790023 | |
114 | Phosphorylation | TRKEEKVTLDPELEE CCCHHCCCCCHHHHH | 36.19 | 20415495 | |
125 | Phosphorylation | ELEEALASASDTELY HHHHHHHCCCCHHHH | 29.20 | 22324799 | |
127 | Phosphorylation | EEALASASDTELYDL HHHHHCCCCHHHHHH | 42.44 | 20415495 | |
129 | Phosphorylation | ALASASDTELYDLAA HHHCCCCHHHHHHHH | 25.95 | 20415495 | |
132 | Phosphorylation | SASDTELYDLAAVLG CCCCHHHHHHHHHHC | 11.59 | 20415495 | |
216 | Ubiquitination | NIPIPTLKEFAKSLE CCCCCHHHHHHHHCC | 53.95 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMOD2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMOD2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMOD2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TMOD2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...