| UniProt ID | TMM8B_HUMAN | |
|---|---|---|
| UniProt AC | A6NDV4 | |
| Protein Name | Transmembrane protein 8B | |
| Gene Name | TMEM8B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 472 | |
| Subcellular Localization |
Isoform 2: Cell membrane Multi-pass membrane protein . Cytoplasm . Nucleus . Mitochondrion . Endoplasmic reticulum . Also detected in mitochondrion and endoplasmic reticulum (PubMed:17641538). |
|
| Protein Description | May function as a regulator of the EGFR pathway. Probable tumor suppressor which may function in cell growth, proliferation and adhesion.. | |
| Protein Sequence | MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFLGSLMSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATAWTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGSVGFLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 92 | N-linked_Glycosylation | LSLELQLNASSVRQE EEEEEEECCCHHCCC | 25.47 | UniProtKB CARBOHYD | |
| 100 | N-linked_Glycosylation | ASSVRQENVTVFGCL CCHHCCCCEEEEEEE | 26.82 | UniProtKB CARBOHYD | |
| 114 | Phosphorylation | LTHEVPLSLGDAAVT EECCCCCCCCCCEEE | 25.00 | 25332170 | |
| 123 | Phosphorylation | GDAAVTCSKESLAGF CCCEEEECHHHHHHH | 30.05 | 25332170 | |
| 135 | Phosphorylation | AGFLLSVSATTRVAR HHHHHHCCCCCEEEE | 19.27 | 25332170 | |
| 372 | Phosphorylation | SVRRRHCYPPTWRRW HHHHHCCCCCCHHHH | 13.21 | 24719451 | |
| 375 | Phosphorylation | RRHCYPPTWRRWLFY HHCCCCCCHHHHHHH | 27.40 | 24719451 | |
| 406 | Phosphorylation | FVETRDNYFYIHSIW HHHCCCCEEEHHHHH | 11.31 | 29116813 | |
| 408 | Phosphorylation | ETRDNYFYIHSIWHM HCCCCEEEHHHHHHH | 6.33 | 29116813 | |
| 420 | Phosphorylation | WHMLIAGSVGFLLPP HHHHHHCCCCCCCCC | 15.28 | 29116813 | |
| 431 | Phosphorylation | LLPPRAKTDHGVPSG CCCCCCCCCCCCCCC | 32.04 | 29116813 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMM8B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMM8B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMM8B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TMM8B_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
