TMM33_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TMM33_RAT
• UniProt AC: Q9Z142
• Protein Name: Transmembrane protein 33
• Gene Name: Tmem33
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 247
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein . Melanosome . Nucleus envelope . Co-localizes with RTN4 at the ER sheets.
• Protein Description: Acts as a regulator of the tubular endoplasmic reticulum (ER) network. Suppresses the RTN3/4-induced formation of the ER tubules. Positively regulates PERK-mediated and IRE1-mediated unfolded protein response signaling..
• Protein Sequence: MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDAKGSNSLPLLRSVLDKLSTNQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAFISRLAPTVA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MADTTPNGP ------CCCCCCCCC	23.90	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TMM33_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TMM33_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TMM33_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of TMM33_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.