UniProt ID | TMM33_MOUSE | |
---|---|---|
UniProt AC | Q9CR67 | |
Protein Name | Transmembrane protein 33 | |
Gene Name | Tmem33 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 247 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Melanosome . Nucleus envelope . Co-localizes with RTN4 at the ER sheets. |
|
Protein Description | Acts as a regulator of the tubular endoplasmic reticulum (ER) network. Suppresses the RTN3/4-induced formation of the ER tubules. Positively regulates PERK-mediated and IRE1-mediated unfolded protein response signaling.. | |
Protein Sequence | MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDAKGSNSLPLLRSFLDKLSTNQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAFISRLAPTVA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADTTPNGP ------CCCCCCCCC | 23.90 | - | |
134 | Ubiquitination | TKKVLDAKGSNSLPL HHHHHCCCCCCCHHH | 63.64 | 22790023 | |
148 | Ubiquitination | LLRSFLDKLSTNQQN HHHHHHHHHCCCHHH | 46.62 | 22790023 | |
221 | Ubiquitination | VVEHIIMKPSCPLFV HHHHHHCCCCCHHHH | 24.30 | - | |
224 | S-palmitoylation | HIIMKPSCPLFVRRL HHHCCCCCHHHHHHH | 4.62 | 28526873 | |
232 | S-palmitoylation | PLFVRRLCLQSIAFI HHHHHHHHHHHHHHH | 2.85 | 28526873 | |
235 | Phosphorylation | VRRLCLQSIAFISRL HHHHHHHHHHHHHHH | 11.70 | 21454597 | |
240 | Phosphorylation | LQSIAFISRLAPTVA HHHHHHHHHHCCCCC | 18.13 | 21454597 | |
245 | Phosphorylation | FISRLAPTVA----- HHHHHCCCCC----- | 24.37 | 21454597 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMM33_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMM33_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMM33_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TMM33_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...