TMM26_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TMM26_MOUSE
• UniProt AC: Q3UP23
• Protein Name: Transmembrane protein 26
• Gene Name: Tmem26
• Organism: Mus musculus (Mouse).
• Sequence Length: 366
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MEGLVLLKALVTRLLFLLHSLVAVWRVTWVKEEHRYWLLALLNLLLVLETVLTLKFKRGRGYKWLSPAIFVYLVNIMPSLWLLEMHHGNQYCSTQSERMAQNFSRRGDVNQTLSSHRATNGMGNILELARGFVDNLSMVCEPVWTLGLHQTLLLILIIGRWLLPIGGTITRDQLSELLLMFVGTAADILEFTTETLKENNVRTNPTLVSGILVVWTWSMLQFPLDLAVQLKLVCPASVKARGFLRVFLCQYSADLWAIGLSFFIQDGPFLVVRLVLMIYFKVINHMLVFFAVKNSLVMALHFYRLVALIMATRDFMRDHPESPKPEHSGPDQPSESGPSEWEDASPEALPLRTSPVTSEESYPTTP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
110	N-linked_Glycosylation	FSRRGDVNQTLSSHR HHHCCCHHHHHHHHH	33.58	-
322	Phosphorylation	FMRDHPESPKPEHSG HHHHCCCCCCCCCCC	42.55	19144319
358	Phosphorylation	LRTSPVTSEESYPTT CCCCCCCCCCCCCCC	39.33	23140645
361	Phosphorylation	SPVTSEESYPTTP-- CCCCCCCCCCCCC--	32.15	23140645
364	Phosphorylation	TSEESYPTTP----- CCCCCCCCCC-----	43.39	23140645
365	Phosphorylation	SEESYPTTP------ CCCCCCCCC------	23.61	23970565

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TMM26_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TMM26_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TMM26_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of TMM26_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.