TMM11_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TMM11_MOUSE
• UniProt AC: Q8BK08
• Protein Name: Transmembrane protein 11, mitochondrial
• Gene Name: Tmem11
• Organism: Mus musculus (Mouse).
• Sequence Length: 190
• Subcellular Localization: Mitochondrion inner membrane ; Multi-pass membrane protein .
• Protein Description: Plays a role in mitochondrial morphogenesis..
• Protein Sequence: MAAWGRRRLGPGGGGSRERVSLSATDCYIVHEIYSGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKVYELYAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	LGPGGGGSRERVSLS CCCCCCCCCCCEEEC	33.95	22802335
78	S-nitrosocysteine	RWITVGNCLHKTAVL EEEEECCHHHHHHHH	3.28	-
78	S-nitrosylation	RWITVGNCLHKTAVL EEEEECCHHHHHHHH	3.28	21278135
78	S-palmitoylation	RWITVGNCLHKTAVL EEEEECCHHHHHHHH	3.28	28680068
140	Malonylation	QVEYDAYKLSRLPLH EEEEEEEHHCCCCCC	41.53	26320211
148	Phosphorylation	LSRLPLHTLTSSTPV HCCCCCCCCCCCCCE	39.14	22871156
151	Phosphorylation	LPLHTLTSSTPVVLV CCCCCCCCCCCEEEE	35.01	22871156
152	Phosphorylation	PLHTLTSSTPVVLVR CCCCCCCCCCEEEEE	31.34	22871156

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TMM11_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TMM11_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TMM11_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of TMM11_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.