UniProt ID | TMM11_MOUSE | |
---|---|---|
UniProt AC | Q8BK08 | |
Protein Name | Transmembrane protein 11, mitochondrial | |
Gene Name | Tmem11 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 190 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Plays a role in mitochondrial morphogenesis.. | |
Protein Sequence | MAAWGRRRLGPGGGGSRERVSLSATDCYIVHEIYSGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKVYELYAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | LGPGGGGSRERVSLS CCCCCCCCCCCEEEC | 33.95 | 22802335 | |
78 | S-nitrosocysteine | RWITVGNCLHKTAVL EEEEECCHHHHHHHH | 3.28 | - | |
78 | S-nitrosylation | RWITVGNCLHKTAVL EEEEECCHHHHHHHH | 3.28 | 21278135 | |
78 | S-palmitoylation | RWITVGNCLHKTAVL EEEEECCHHHHHHHH | 3.28 | 28680068 | |
140 | Malonylation | QVEYDAYKLSRLPLH EEEEEEEHHCCCCCC | 41.53 | 26320211 | |
148 | Phosphorylation | LSRLPLHTLTSSTPV HCCCCCCCCCCCCCE | 39.14 | 22871156 | |
151 | Phosphorylation | LPLHTLTSSTPVVLV CCCCCCCCCCCEEEE | 35.01 | 22871156 | |
152 | Phosphorylation | PLHTLTSSTPVVLVR CCCCCCCCCCEEEEE | 31.34 | 22871156 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMM11_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMM11_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMM11_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TMM11_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...