TMEDA_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TMEDA_DROME
• UniProt AC: Q8SXY6
• Protein Name: Transmembrane emp24 domain-containing protein bai {ECO:0000303|PubMed:15327786, ECO:0000312|FlyBase:FBgn0045866}
• Gene Name: bai
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 206
• Subcellular Localization: Membrane; Single-pass type I membrane protein .
• Protein Description: Eca and bai are essential, though not redundant, for dorsoventral patterning of the embryo. Specifically required during early embryogenesis for the activity of maternal tkv, while the zygotic tkv is not affected..
• Protein Sequence: MARAAFIVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQIIDYIARDTKGHILSQKEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVIQEVSLLTKKGVETKSYEGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLGLATWQVLYLRRYFKAKKLIE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TMEDA_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TMEDA_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TMEDA_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TMEDA_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
WNTG_DROME	wg	physical	26002470

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.