UniProt ID | TMED9_MOUSE | |
---|---|---|
UniProt AC | Q99KF1 | |
Protein Name | Transmembrane emp24 domain-containing protein 9 | |
Gene Name | Tmed9 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 235 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein. Golgi apparatus, cis-Golgi network membrane Single-pass type I membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane Single-pass type I membrane protein. Golg |
|
Protein Description | Appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway. In COPI vesicle-mediated retrograde transport involved in the coatomer recruitment to membranes of the early secretory pathway. Increases coatomer-dependent activity of ARFGAP2. Thought to play a crucial role in the specific retention of p24 complexes in cis-Golgi membranes; specifically contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. May be involved in organization of intracellular membranes, such as of the ER-Golgi intermediate compartment and the Golgi apparatus. Involved in ER localization of PTPN2 (By similarity).. | |
Protein Sequence | MAAVRGVRVVGSSPGLLLGRGMRAFLLLLWLAARGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 | Phosphorylation | IEEIPDETMVIGNYR EEECCCCEEEEECEE | 24.90 | 26643407 | |
64 | Phosphorylation | ETMVIGNYRTQLYDK CEEEEECEECCCHHH | 15.15 | 26643407 | |
125 | N-linked_Glycosylation | HQICLHSNSTKFSLF CEEEEECCCCEEEEE | 42.84 | - | |
160 | Acetylation | AEIAAKDKLSELQLR HHHHHHHHHHHHHHH | 53.88 | 23806337 | |
180 | Ubiquitination | EQVEQIQKEQNYQRW HHHHHHHHHHHHHHH | 64.00 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMED9_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMED9_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMED9_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TMED9_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...