| UniProt ID | TMED9_MOUSE | |
|---|---|---|
| UniProt AC | Q99KF1 | |
| Protein Name | Transmembrane emp24 domain-containing protein 9 | |
| Gene Name | Tmed9 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 235 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein. Golgi apparatus, cis-Golgi network membrane Single-pass type I membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane Single-pass type I membrane protein. Golg |
|
| Protein Description | Appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway. In COPI vesicle-mediated retrograde transport involved in the coatomer recruitment to membranes of the early secretory pathway. Increases coatomer-dependent activity of ARFGAP2. Thought to play a crucial role in the specific retention of p24 complexes in cis-Golgi membranes; specifically contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. May be involved in organization of intracellular membranes, such as of the ER-Golgi intermediate compartment and the Golgi apparatus. Involved in ER localization of PTPN2 (By similarity).. | |
| Protein Sequence | MAAVRGVRVVGSSPGLLLGRGMRAFLLLLWLAARGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 58 | Phosphorylation | IEEIPDETMVIGNYR EEECCCCEEEEECEE | 24.90 | 26643407 | |
| 64 | Phosphorylation | ETMVIGNYRTQLYDK CEEEEECEECCCHHH | 15.15 | 26643407 | |
| 125 | N-linked_Glycosylation | HQICLHSNSTKFSLF CEEEEECCCCEEEEE | 42.84 | - | |
| 160 | Acetylation | AEIAAKDKLSELQLR HHHHHHHHHHHHHHH | 53.88 | 23806337 | |
| 180 | Ubiquitination | EQVEQIQKEQNYQRW HHHHHHHHHHHHHHH | 64.00 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMED9_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMED9_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMED9_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TMED9_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
