UniProt ID | TMED5_HUMAN | |
---|---|---|
UniProt AC | Q9Y3A6 | |
Protein Name | Transmembrane emp24 domain-containing protein 5 | |
Gene Name | TMED5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 229 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein . Golgi apparatus, cis-Golgi network membrane Single-pass type I membrane protein . Endoplasmic reticulum-Golgi intermediate compartment membrane Single-pass type I membrane protein |
|
Protein Description | Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Required for the maintenance of the Golgi apparatus; involved in protein exchange between Golgi stacks during assembly. Probably not required for COPI-vesicle-mediated retrograde transport.. | |
Protein Sequence | MGDKIWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEIEYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTVETEVGDYMFCFDNTFSTISEKVIFFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVVSAIQVYMLKSLFEDKRKSRT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
49 | Phosphorylation | AGQKECFYQPMPLKA CCCCEEECCCCCEEE | 24.30 | 25072903 | |
141 | 2-Hydroxyisobutyrylation | QEQEDWKKYITGTDI HHHHHHHHHHCCCHH | 37.32 | - | |
144 | Phosphorylation | EDWKKYITGTDILDM HHHHHHHCCCHHHHC | 30.82 | - | |
144 (in isoform 2) | Phosphorylation | - | 30.82 | 22210691 | |
146 (in isoform 2) | Phosphorylation | - | 15.94 | 22210691 | |
164 | Ubiquitination | LESINSIKSRLSKSG HHHHHHHHHHHCCCC | 29.37 | 21906983 | |
164 | 2-Hydroxyisobutyrylation | LESINSIKSRLSKSG HHHHHHHHHHHCCCC | 29.37 | - | |
165 | Phosphorylation | ESINSIKSRLSKSGH HHHHHHHHHHCCCCC | 36.46 | 27251275 | |
168 | Phosphorylation | NSIKSRLSKSGHIQT HHHHHHHCCCCCHHH | 24.54 | 28348404 | |
169 | Ubiquitination | SIKSRLSKSGHIQTL HHHHHHCCCCCHHHH | 66.11 | 21906983 | |
170 | Phosphorylation | IKSRLSKSGHIQTLL HHHHHCCCCCHHHHH | 32.03 | 24719451 | |
175 | Phosphorylation | SKSGHIQTLLRAFEA CCCCCHHHHHHHHHH | 27.44 | 24719451 | |
199 | Phosphorylation | FDRVNFWSMVNLVVM CCHHCHHHHHHHHHH | 14.55 | 24043423 | |
210 | Phosphorylation | LVVMVVVSAIQVYML HHHHHHHHHHHHHHH | 14.19 | 24043423 | |
215 | Phosphorylation | VVSAIQVYMLKSLFE HHHHHHHHHHHHHHH | 4.75 | 24043423 | |
224 | Acetylation | LKSLFEDKRKSRT-- HHHHHHHHHHHCC-- | 55.30 | 27452117 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMED5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMED5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMED5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ANM6_HUMAN | PRMT6 | physical | 23455924 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...