| UniProt ID | TMED5_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y3A6 | |
| Protein Name | Transmembrane emp24 domain-containing protein 5 | |
| Gene Name | TMED5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 229 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein . Golgi apparatus, cis-Golgi network membrane Single-pass type I membrane protein . Endoplasmic reticulum-Golgi intermediate compartment membrane Single-pass type I membrane protein |
|
| Protein Description | Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Required for the maintenance of the Golgi apparatus; involved in protein exchange between Golgi stacks during assembly. Probably not required for COPI-vesicle-mediated retrograde transport.. | |
| Protein Sequence | MGDKIWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEIEYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTVETEVGDYMFCFDNTFSTISEKVIFFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVVSAIQVYMLKSLFEDKRKSRT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 49 | Phosphorylation | AGQKECFYQPMPLKA CCCCEEECCCCCEEE | 24.30 | 25072903 | |
| 141 | 2-Hydroxyisobutyrylation | QEQEDWKKYITGTDI HHHHHHHHHHCCCHH | 37.32 | - | |
| 144 | Phosphorylation | EDWKKYITGTDILDM HHHHHHHCCCHHHHC | 30.82 | - | |
| 144 (in isoform 2) | Phosphorylation | - | 30.82 | 22210691 | |
| 146 (in isoform 2) | Phosphorylation | - | 15.94 | 22210691 | |
| 164 | Ubiquitination | LESINSIKSRLSKSG HHHHHHHHHHHCCCC | 29.37 | 21906983 | |
| 164 | 2-Hydroxyisobutyrylation | LESINSIKSRLSKSG HHHHHHHHHHHCCCC | 29.37 | - | |
| 165 | Phosphorylation | ESINSIKSRLSKSGH HHHHHHHHHHCCCCC | 36.46 | 27251275 | |
| 168 | Phosphorylation | NSIKSRLSKSGHIQT HHHHHHHCCCCCHHH | 24.54 | 28348404 | |
| 169 | Ubiquitination | SIKSRLSKSGHIQTL HHHHHHCCCCCHHHH | 66.11 | 21906983 | |
| 170 | Phosphorylation | IKSRLSKSGHIQTLL HHHHHCCCCCHHHHH | 32.03 | 24719451 | |
| 175 | Phosphorylation | SKSGHIQTLLRAFEA CCCCCHHHHHHHHHH | 27.44 | 24719451 | |
| 199 | Phosphorylation | FDRVNFWSMVNLVVM CCHHCHHHHHHHHHH | 14.55 | 24043423 | |
| 210 | Phosphorylation | LVVMVVVSAIQVYML HHHHHHHHHHHHHHH | 14.19 | 24043423 | |
| 215 | Phosphorylation | VVSAIQVYMLKSLFE HHHHHHHHHHHHHHH | 4.75 | 24043423 | |
| 224 | Acetylation | LKSLFEDKRKSRT-- HHHHHHHHHHHCC-- | 55.30 | 27452117 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMED5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMED5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMED5_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ANM6_HUMAN | PRMT6 | physical | 23455924 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
