TM86B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TM86B_HUMAN
• UniProt AC: Q8N661
• Protein Name: Lysoplasmalogenase
• Gene Name: TMEM86B
• Organism: Homo sapiens (Human).
• Sequence Length: 226
• Subcellular Localization: Membrane ; Multi-pass membrane protein . Cytoplasm .
• Protein Description: Enzyme catalyzing the degradation of lysoplasmalogen. Lysoplasmalogens are formed by the hydrolysis of the abundant membrane glycerophospholipids plasmalogens. May control the respective levels of plasmalogens and lysoplasmalogens in cells and modulate cell membrane properties..
• Protein Sequence: MDAGKAGQTLKTHCSAQRPDVCRWLSPFILSCCVYFCLWIPEDQLSWFAALVKCLPVLCLAGFLWVMSPSGGYTQLLQGALVCSAVGDACLIWPAAFVPGMAAFATAHLLYVWAFGFSPLQPGLLLLIILAPGPYLSLVLQHLEPDMVLPVAAYGLILMAMLWRGLAQGGSAGWGALLFTLSDGVLAWDTFAQPLPHAHLVIMTTYYAAQLLITLSALRSPVPKTD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
216	Phosphorylation	AQLLITLSALRSPVP HHHHHHHHHHCCCCC	19.33	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TM86B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TM86B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TM86B_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of TM86B_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.