TM86A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TM86A_HUMAN
• UniProt AC: Q8N2M4
• Protein Name: Lysoplasmalogenase-like protein TMEM86A
• Gene Name: TMEM86A
• Organism: Homo sapiens (Human).
• Sequence Length: 240
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSTLIKCLPIFCLWLFLLAHGLGFLLAHPSATRIFVGLVFSAVGDAFLIWQDQGYFVHGLLMFAVTHMFYASAFGMQPLALRTGLVMAALSGLCYALLYPCLSGAFTYLVGVYVALIGFMGWRAMAGLRLAGADWRWTELAAGSGALFFIISDLTIALNKFCFPVPYSRALIMSTYYVAQMLVALSAVESREPVEHYRLTKAN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
211	Phosphorylation	YSRALIMSTYYVAQM CHHHHHHHHHHHHHH	13.28	26503514
212	Phosphorylation	SRALIMSTYYVAQML HHHHHHHHHHHHHHH	11.07	26503514
213	Phosphorylation	RALIMSTYYVAQMLV HHHHHHHHHHHHHHH	6.66	26503514
214	Phosphorylation	ALIMSTYYVAQMLVA HHHHHHHHHHHHHHH	6.87	26503514

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TM86A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TM86A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TM86A_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of TM86A_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.