TM50A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TM50A_HUMAN
• UniProt AC: O95807
• Protein Name: Transmembrane protein 50A
• Gene Name: TMEM50A
• Organism: Homo sapiens (Human).
• Sequence Length: 157
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACGVIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYVAKEKDIVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSGFLEGLR ------CCCCCCCCC	37.95	22223895
2	Phosphorylation	------MSGFLEGLR ------CCCCCCCCC	37.95	23025827
10	S-palmitoylation	GFLEGLRCSECIDWG CCCCCCCHHHCCCHH	4.89	29575903
13	S-palmitoylation	EGLRCSECIDWGEKR CCCCHHHCCCHHHHH	1.64	29575903
19	Ubiquitination	ECIDWGEKRNTIASI HCCCHHHHHHHHHHH	47.19	21906983
64	Phosphorylation	HACGVIATIAFLMIN HHHHHHHHHHHHHHH	11.17	16094384
107	Phosphorylation	GFMLAFGSLIASMWI HHHHHHHHHHHHHHH	15.34	30257219
119	Phosphorylation	MWILFGGYVAKEKDI HHHHHCCHHCCCCCC	9.52	30257219

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TM50A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TM50A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TM50A_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of TM50A_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Quantitative phosphoproteome analysis using a dendrimer conjugationchemistry and tandem mass spectrometry.";
Tao W.A., Wollscheid B., O'Brien R., Eng J.K., Li X.-J.,Bodenmiller B., Watts J.D., Hood L., Aebersold R.;
Nat. Methods 2:591-598(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-64, AND MASSSPECTROMETRY.
PubMed: 16094384