| UniProt ID | TM2D1_HUMAN | |
|---|---|---|
| UniProt AC | Q9BX74 | |
| Protein Name | TM2 domain-containing protein 1 | |
| Gene Name | TM2D1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 207 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | May participate in amyloid-beta-induced apoptosis via its interaction with beta-APP42.. | |
| Protein Sequence | MAAAWPSGPSAPEAVTARLVGVLWFVSVTTGPWGAVATSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 52 | Ubiquitination | SLKCEDLKVGQYICK CCCCCCCCCCEEEEC | 57.55 | 29967540 | |
| 59 | Ubiquitination | KVGQYICKDPKINDA CCCEEEECCCCCCCC | 68.46 | 29967540 | |
| 72 | N-linked_Glycosylation | DATQEPVNCTNYTAH CCCCCCCCCCCCEEE | 37.30 | UniProtKB CARBOHYD | |
| 87 | N-linked_Glycosylation | VSCFPAPNITCKDSS EEEEECCCCEEECCC | 44.29 | UniProtKB CARBOHYD | |
| 96 | N-linked_Glycosylation | TCKDSSGNETHFTGN EEECCCCCEEEECCC | 53.60 | UniProtKB CARBOHYD | |
| 109 | Ubiquitination | GNEVGFFKPISCRNV CCCCEEECEEEEECC | 38.90 | - | |
| 197 | N-linked_Glycosylation | LTRLSITNETFRKTQ EEEEEEECCCHHHCC | 44.64 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM2D1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM2D1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM2D1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TM2D1_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...