UniProt ID | TM2D1_HUMAN | |
---|---|---|
UniProt AC | Q9BX74 | |
Protein Name | TM2 domain-containing protein 1 | |
Gene Name | TM2D1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 207 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | May participate in amyloid-beta-induced apoptosis via its interaction with beta-APP42.. | |
Protein Sequence | MAAAWPSGPSAPEAVTARLVGVLWFVSVTTGPWGAVATSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Ubiquitination | SLKCEDLKVGQYICK CCCCCCCCCCEEEEC | 57.55 | 29967540 | |
59 | Ubiquitination | KVGQYICKDPKINDA CCCEEEECCCCCCCC | 68.46 | 29967540 | |
72 | N-linked_Glycosylation | DATQEPVNCTNYTAH CCCCCCCCCCCCEEE | 37.30 | UniProtKB CARBOHYD | |
87 | N-linked_Glycosylation | VSCFPAPNITCKDSS EEEEECCCCEEECCC | 44.29 | UniProtKB CARBOHYD | |
96 | N-linked_Glycosylation | TCKDSSGNETHFTGN EEECCCCCEEEECCC | 53.60 | UniProtKB CARBOHYD | |
109 | Ubiquitination | GNEVGFFKPISCRNV CCCCEEECEEEEECC | 38.90 | - | |
197 | N-linked_Glycosylation | LTRLSITNETFRKTQ EEEEEEECCCHHHCC | 44.64 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM2D1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM2D1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM2D1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TM2D1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...