UniProt ID | TM242_HUMAN | |
---|---|---|
UniProt AC | Q9NWH2 | |
Protein Name | Transmembrane protein 242 | |
Gene Name | TMEM242 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 141 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEWFNKGSMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMNDFRSKMQSIFPTIPKNSESAVEWEETLKSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------METAGAAT -------CCCCCCCC | 10.48 | 22814378 | |
8 | Phosphorylation | METAGAATGQPASGL CCCCCCCCCCCCCCC | 35.50 | 24719451 | |
21 | Phosphorylation | GLEAPGSTNDRLFLV CCCCCCCCCCCEEEE | 47.24 | 24719451 | |
48 | Phosphorylation | GMLAGFITTLSLAKK HHHHHHHHHHHHHHH | 21.30 | - | |
49 | Phosphorylation | MLAGFITTLSLAKKK HHHHHHHHHHHHHHC | 14.99 | - | |
51 | Phosphorylation | AGFITTLSLAKKKSP HHHHHHHHHHHHCCH | 24.96 | - | |
89 | Phosphorylation | ALGWGSLYAWCGVGV HHCCHHHHHHHHHHH | 10.35 | - | |
116 | Ubiquitination | SMNDFRSKMQSIFPT CHHHHHHHHHHHCCC | 36.38 | 27667366 | |
139 | Ubiquitination | VEWEETLKSK----- CCHHHHHHCC----- | 64.71 | 32015554 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM242_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM242_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM242_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TM242_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...