| UniProt ID | TM225_HUMAN | |
|---|---|---|
| UniProt AC | Q6GV28 | |
| Protein Name | Transmembrane protein 225 | |
| Gene Name | TMEM225 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 225 | |
| Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, acrosome membrane Multi-pass membrane protein . |
|
| Protein Description | Probably inhibits protein phosphatase 1 (PP1) in sperm via binding to catalytic subunit PPP1CC.. | |
| Protein Sequence | MVHVSNRSIQGMNILFSSWAVVLMVMGITLDKWVELISEDERAKMNHSPWMMCCPALWPEDDLKVVRIMMTSSLGLSFLLNLILGMKFTYLIPQNKYIQLFTTILSFFSGISLLWALILYHNKLKQGQSMHFSNYRITWIMYTAYLNVFFLSVCGVLSLLECKLSTSSCTCLNIHKSDNECKESENSIEDISLPECTAMPRSIVRAHTVNSLNKKVQTRHVTWAL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 77 | Phosphorylation | MTSSLGLSFLLNLIL HCHHHHHHHHHHHHH | 16.43 | - | |
| 97 | Phosphorylation | YLIPQNKYIQLFTTI EEECCCHHHHHHHHH | 11.05 | 24043423 | |
| 102 | Phosphorylation | NKYIQLFTTILSFFS CHHHHHHHHHHHHHH | 22.86 | 24043423 | |
| 103 | Phosphorylation | KYIQLFTTILSFFSG HHHHHHHHHHHHHHH | 16.76 | 24043423 | |
| 106 | Phosphorylation | QLFTTILSFFSGISL HHHHHHHHHHHHHHH | 22.01 | 24043423 | |
| 109 | Phosphorylation | TTILSFFSGISLLWA HHHHHHHHHHHHHHH | 32.95 | 24043423 | |
| 112 | Phosphorylation | LSFFSGISLLWALIL HHHHHHHHHHHHHHH | 22.42 | 24043423 | |
| 120 | Phosphorylation | LLWALILYHNKLKQG HHHHHHHHHHCHHCC | 9.06 | 24043423 | |
| 129 | Phosphorylation | NKLKQGQSMHFSNYR HCHHCCCCCCCCCCH | 22.50 | 30206219 | |
| 133 | Phosphorylation | QGQSMHFSNYRITWI CCCCCCCCCCHHHHH | 20.48 | 30206219 | |
| 135 | Phosphorylation | QSMHFSNYRITWIMY CCCCCCCCHHHHHHH | 11.38 | 30206219 | |
| 214 | Acetylation | HTVNSLNKKVQTRHV HHHHHHCHHHHHHCC | 60.66 | 19413330 | |
| 218 | Phosphorylation | SLNKKVQTRHVTWAL HHCHHHHHHCCCCCC | 26.23 | 19413330 | |
| 222 | Phosphorylation | KVQTRHVTWAL---- HHHHHCCCCCC---- | 10.01 | 22985185 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM225_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM225_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM225_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TM225_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
