TM218_HUMAN - dbPTM
TM218_HUMAN - PTM Information in dbPTM
Basic Information of Protein
UniProt ID TM218_HUMAN
UniProt AC A2RU14
Protein Name Transmembrane protein 218
Gene Name TMEM218
Organism Homo sapiens (Human).
Sequence Length 115
Subcellular Localization Membrane
Multi-pass membrane protein . Cell projection, cilium . Localizes at the transition zone, a region between the basal body and the ciliary axoneme.
Protein Description May be involved in ciliary biogenesis or function..
Protein Sequence MAGTVLGVGAGVFILALLWVAVLLLCVLLSRASGAARFSVIFLFFGAVIITSVLLLFPRAGEFPAPEVEVKIVDDFFIGRYVLLAFLSAIFLGGLFLVLIHYVLEPIYAKPLHSY
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of TM218_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of TM218_HUMAN !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of TM218_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of TM218_HUMAN !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
LRAD1_HUMANLDLRAD1physical
25416956

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of TM218_HUMAN

loading...

Related Literatures of Post-Translational Modification

TOP