TM208_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TM208_HUMAN
• UniProt AC: Q9BTX3
• Protein Name: Transmembrane protein 208
• Gene Name: TMEM208
• Organism: Homo sapiens (Human).
• Sequence Length: 173
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: May function as a negative regulator of endoplasmic reticulum-stress induced autophagy..
• Protein Sequence: MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHSMSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVNVLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MAPKGKVG -------CCCCCCCC	15.08	25732826

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TM208_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TM208_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TM208_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of TM208_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.