dbPTM

TM190_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TM190_HUMAN
UniProt AC	Q8WZ59
Protein Name	Transmembrane protein 190
Gene Name	TMEM190
Organism	Homo sapiens (Human).
Sequence Length	177
Subcellular Localization	Membrane Single-pass type I membrane protein.
Protein Description
Protein Sequence	MLGCGIPALGLLLLLQGSADGNGIQGFFYPWSCEGDIWDRESCGGQAAIDSPNLCLRLRCCYRNGVCYHQRPDENVRRKHMWALVWTCSGLLLLSCSICLFWWAKRRDVLHMPGFLAGPCDMSKSVSLLSKHRGTKKTPSTGSVPVALSKESRDVEGGTEGEGTEEGEETEGEEEED

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
123	Phosphorylation	LAGPCDMSKSVSLLS CCCCCCCHHHHHHHH	14.45	25693802
125	Phosphorylation	GPCDMSKSVSLLSKH CCCCCHHHHHHHHHC	15.05	30622161
127	Phosphorylation	CDMSKSVSLLSKHRG CCCHHHHHHHHHCCC	30.59	24719451
130	Phosphorylation	SKSVSLLSKHRGTKK HHHHHHHHHCCCCCC	31.54	30622161
138	Phosphorylation	KHRGTKKTPSTGSVP HCCCCCCCCCCCCCC	24.83	30622161
140	Phosphorylation	RGTKKTPSTGSVPVA CCCCCCCCCCCCCEE	51.11	30622161
141	Phosphorylation	GTKKTPSTGSVPVAL CCCCCCCCCCCCEEE	34.38	30622161
143	Phosphorylation	KKTPSTGSVPVALSK CCCCCCCCCCEEEEC	24.28	30622161
149	Phosphorylation	GSVPVALSKESRDVE CCCCEEEECCCCCCC	25.33	30622161
152	Phosphorylation	PVALSKESRDVEGGT CEEEECCCCCCCCCC	37.20	30622161

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TM190_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TM190_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TM190_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
LRAD1_HUMAN	LDLRAD1	physical	25416956

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TM190_HUMAN

Related Literatures of Post-Translational Modification