| UniProt ID | TM160_MOUSE | |
|---|---|---|
| UniProt AC | Q9D938 | |
| Protein Name | Transmembrane protein 160 | |
| Gene Name | Tmem160 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 188 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MGGGWWWARVARLARLRFRGSLQPPQRPRSGGARGSFAPGHGPRAGASPPPVSELDRADAWLLRKAHETAFLSWFRNGLLSSGIGVISFMQSDMGREAAYGFFLLGGLCVVWGGASYAVGLAALRGPMQLSLAGAAAGVGAVLAASLLWACAVGLYMGQLELDVELVPEDDGAASTEGPDEAGRPPPE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 34 | Methylation | RPRSGGARGSFAPGH CCCCCCCCCCCCCCC | 44.56 | 58860149 | |
| 36 | Phosphorylation | RSGGARGSFAPGHGP CCCCCCCCCCCCCCC | 16.81 | 28418008 | |
| 48 | Phosphorylation | HGPRAGASPPPVSEL CCCCCCCCCCCCHHH | 36.70 | 28066266 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM160_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM160_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM160_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TM160_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...