UniProt ID | TM14C_MOUSE | |
---|---|---|
UniProt AC | Q9CQN6 | |
Protein Name | Transmembrane protein 14C | |
Gene Name | Tmem14c | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 114 | |
Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein. |
|
Protein Description | Required for normal heme biosynthesis.. | |
Protein Sequence | MQKDSGPLMPLHYFGFGYAALVATGGIIGYAKAGSVPSLAAGLFFGGLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYNSGKFMPAGLIAGASLLMVAKVGISLLSSPHP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
69 | Phosphorylation | NVWVFLATSGTLAGI CEEEEEEECCCHHHH | 29.81 | - | |
70 | Phosphorylation | VWVFLATSGTLAGIM EEEEEEECCCHHHHH | 24.95 | - | |
110 | Phosphorylation | KVGISLLSSPHP--- HHHHHHHCCCCC--- | 47.30 | 26643407 | |
111 | Phosphorylation | VGISLLSSPHP---- HHHHHHCCCCC---- | 27.48 | 26643407 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM14C_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM14C_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM14C_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TM14C_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...