UniProt ID | TM134_HUMAN | |
---|---|---|
UniProt AC | Q9H6X4 | |
Protein Name | Transmembrane protein 134 | |
Gene Name | TMEM134 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 195 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . Cytoplasm, perinuclear region . |
|
Protein Description | ||
Protein Sequence | MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVVLASFLLLLLGLVLILVGVGLEATPSPGVSSAIFFVPGFLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYFEK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | SAARPQFSIDDAFEL CCCCCCCCCCCCEEE | 21.62 | 28348404 | |
17 | Phosphorylation | IDDAFELSLEDGGPG CCCCEEEECCCCCCC | 23.63 | 28348404 | |
53 | Phosphorylation | VADEDKQSRLRYQNL ECCCCHHHHHHHHCC | 38.74 | 25849741 | |
57 | Phosphorylation | DKQSRLRYQNLENDE CHHHHHHHHCCCCCC | 13.32 | 21945579 | |
70 | Phosphorylation | DEDGAQASPEPDGGV CCCCCCCCCCCCCCC | 20.09 | 25849741 | |
82 | Phosphorylation | GGVGTRDSSRTSIRS CCCCCCCCCCCCCHH | 20.59 | 28102081 | |
83 | Phosphorylation | GVGTRDSSRTSIRSS CCCCCCCCCCCCHHC | 43.81 | 28102081 | |
85 | Phosphorylation | GTRDSSRTSIRSSQW CCCCCCCCCCHHCCE | 30.38 | 28102081 | |
86 | Phosphorylation | TRDSSRTSIRSSQWS CCCCCCCCCHHCCEE | 18.20 | 28102081 | |
89 | Phosphorylation | SSRTSIRSSQWSFST CCCCCCHHCCEEEEE | 25.80 | 30108239 | |
90 | Phosphorylation | SRTSIRSSQWSFSTI CCCCCHHCCEEEEEC | 26.31 | 30108239 | |
93 | Phosphorylation | SIRSSQWSFSTISSS CCHHCCEEEEECCCC | 11.15 | 26657352 | |
95 | Phosphorylation | RSSQWSFSTISSSTQ HHCCEEEEECCCCCC | 21.22 | 25072903 | |
96 | Phosphorylation | SSQWSFSTISSSTQR HCCEEEEECCCCCCC | 23.91 | 30108239 | |
98 | Phosphorylation | QWSFSTISSSTQRSY CEEEEECCCCCCCCC | 20.51 | 25072903 | |
99 | Phosphorylation | WSFSTISSSTQRSYN EEEEECCCCCCCCCC | 33.29 | 27080861 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM134_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM134_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM134_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TM134_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...