UniProt ID | TM101_HUMAN | |
---|---|---|
UniProt AC | Q96IK0 | |
Protein Name | Transmembrane protein 101 | |
Gene Name | TMEM101 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 257 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | May activate NF-kappa-B signaling pathways.. | |
Protein Sequence | MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMGAAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGFLVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMIQLFFVLYGILALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHNTRRVEFWNQMKLLGESVGIFGTAVILATDG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
110 | Phosphorylation | DWLKVRMYSRTVAII CHHHHHCCCCEEEEE | 5.62 | 24043423 | |
111 | Phosphorylation | WLKVRMYSRTVAIIG HHHHHCCCCEEEEEH | 16.48 | 24043423 | |
113 | Phosphorylation | KVRMYSRTVAIIGGF HHHCCCCEEEEEHHH | 14.35 | 24043423 | |
125 | Phosphorylation | GGFLVLASGAGELYR HHHHHHCCCCHHHHH | 25.64 | 24043423 | |
131 | Phosphorylation | ASGAGELYRRKPRSR CCCCHHHHHCCCCCC | 12.22 | 24043423 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM101_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM101_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM101_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TM101_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...