TLR1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TLR1_DROME
• UniProt AC: P30974
• Protein Name: Tachykinin-like peptides receptor 86C
• Gene Name: TkR86C
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 504
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein .
• Protein Description: Receptor for tachykinin-like peptides..
• Protein Sequence: MSEIVDTELLVNCTILAVRRFELNSIVNTTLLGSLNRTEVVSLLSSIIDNRDNLESINEAKDFLTECLFPSPTRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKVRIILVLIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFFIYAYHNNQVASTKYVQHMYLGFYWLAMSNAMVNPLIYYWMNKRFRMYFQRIICCCCVGLTRHRFDSPKSRLTNKNSSNRHTRAETKSQWKRSTMETQIQQAPVTSSCREQRSAQQQQPPGSGTNRAAVECIMERPADGSSSPLCLSINNSIGERQRVKIKYISCDEDNNPVELSPKQM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	N-linked_Glycosylation	VDTELLVNCTILAVR CCHHHHHHCEEEEEE	19.72	-
28	N-linked_Glycosylation	FELNSIVNTTLLGSL CCHHHHHCCHHHCCC	26.19	-
36	N-linked_Glycosylation	TTLLGSLNRTEVVSL CHHHCCCCHHHHHHH	50.99	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TLR1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TLR1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TLR1_DROME !!

Protein-Protein Interaction

Oops, there are no PPI records of TLR1_DROME !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.