UniProt ID | TLG1_SCHPO | |
---|---|---|
UniProt AC | Q9HGN3 | |
Protein Name | t-SNARE affecting a late Golgi compartment protein 1 | |
Gene Name | tlg1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 225 | |
Subcellular Localization |
Golgi apparatus, trans-Golgi network membrane Single-pass type IV membrane protein. Endosome membrane Single-pass type IV membrane protein. Probably shuttling between TGN and early/late endosome.. |
|
Protein Description | ||
Protein Sequence | MEDPFYEVKADASNQMEQVRKLYNSFMAARNSGVLSPNTELTYAIDELSETLKDLKAAVEIAMKNSEHFGLDEEELKSRRRFVSELDIELNNIQLKMGAAPSTPVSTEPYTVDNGASAGLSEEDHAVNRQYQEQLYQQQDVMLDGVYDTIGNIRGQAALMGEELGQQADLLDTLDNSIETTNSKLRRGMKRLKDFTIASADSKSGCCITVLIIILIALLVLVIVL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Phosphorylation | ARNSGVLSPNTELTY HHHCCCCCCCHHHHH | 17.44 | 29996109 | |
103 | Phosphorylation | KMGAAPSTPVSTEPY EECCCCCCCCCCCCE | 27.01 | 29996109 | |
117 | Phosphorylation | YTVDNGASAGLSEED EECCCCCCCCCCHHH | 25.03 | 29996109 | |
121 | Phosphorylation | NGASAGLSEEDHAVN CCCCCCCCHHHHHHH | 37.71 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TLG1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TLG1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TLG1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TLG1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...