TLG1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TLG1_SCHPO
• UniProt AC: Q9HGN3
• Protein Name: t-SNARE affecting a late Golgi compartment protein 1
• Gene Name: tlg1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 225
• Subcellular Localization: Golgi apparatus, trans-Golgi network membrane; Single-pass type IV membrane protein. Endosome membrane; Single-pass type IV membrane protein. Probably shuttling between TGN and early/late endosome..
• Protein Sequence: MEDPFYEVKADASNQMEQVRKLYNSFMAARNSGVLSPNTELTYAIDELSETLKDLKAAVEIAMKNSEHFGLDEEELKSRRRFVSELDIELNNIQLKMGAAPSTPVSTEPYTVDNGASAGLSEEDHAVNRQYQEQLYQQQDVMLDGVYDTIGNIRGQAALMGEELGQQADLLDTLDNSIETTNSKLRRGMKRLKDFTIASADSKSGCCITVLIIILIALLVLVIVL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Phosphorylation	ARNSGVLSPNTELTY HHHCCCCCCCHHHHH	17.44	29996109
103	Phosphorylation	KMGAAPSTPVSTEPY EECCCCCCCCCCCCE	27.01	29996109
117	Phosphorylation	YTVDNGASAGLSEED EECCCCCCCCCCHHH	25.03	29996109
121	Phosphorylation	NGASAGLSEEDHAVN CCCCCCCCHHHHHHH	37.71	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TLG1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TLG1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TLG1_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of TLG1_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.