TLCD2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TLCD2_HUMAN
• UniProt AC: A6NGC4
• Protein Name: TLC domain-containing protein 2
• Gene Name: TLCD2
• Organism: Homo sapiens (Human).
• Sequence Length: 264
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MAPTGLLVAGASFLAFRGLHWGLRRLPTPESAARDRWQWWNLCVSLAHSLLSGTGALLGLSLYPQMAADPIHGHPRWALVLVAVSVGYFLADGADLLWNQTLGKTWDLLCHHLVVVSCLSTAVLSGHYVGFSMVSLLLELNSACLHLRKLLLLSRQAPSLAFSVTSWASLATLALFRLVPLGWMSLWLFRQHHQVPLALVTLGGIGLVTVGIMSIILGIRILVNDVLQSRPHPPSPGHEKTRGTRTRRDNGPVTSNSSTLSLKD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
235	Phosphorylation	QSRPHPPSPGHEKTR HHCCCCCCCCCCCCC	48.22	29978859
255	Phosphorylation	RDNGPVTSNSSTLSL CCCCCCCCCCCCEEC	34.64	23312004
257	Phosphorylation	NGPVTSNSSTLSLKD CCCCCCCCCCEECCC	25.19	28348404
258	Phosphorylation	GPVTSNSSTLSLKD- CCCCCCCCCEECCC-	37.30	28348404
259	Phosphorylation	PVTSNSSTLSLKD-- CCCCCCCCEECCC--	21.86	28348404
261	Phosphorylation	TSNSSTLSLKD---- CCCCCCEECCC----	33.20	24670416

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TLCD2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TLCD2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TLCD2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of TLCD2_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.