UniProt ID | TLCD1_HUMAN | |
---|---|---|
UniProt AC | Q96CP7 | |
Protein Name | Calfacilitin | |
Gene Name | TLCD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 247 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Calcium channel facilitator that increases calcium flux by generating a larger window current and slowing inactivation of the L-type CACNA1C/CaV1.2 channel. Regulation of intracellular calcium by Calfacilitin is required for neural plate formation (By similarity).. | |
Protein Sequence | MPRLLHPALPLLLGATLTFRALRRALCRLPLPVHVRADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
160 | Phosphorylation | IRMMMKISNAQDHLL HHHHHHHCCHHHHHH | 22.16 | - | |
173 | Phosphorylation | LLYRVNKYVNLVMYF HHHHHHHHHHHHHHH | 6.86 | 26126808 | |
179 | Phosphorylation | KYVNLVMYFLFRLAP HHHHHHHHHHHHHCC | 6.94 | 26126808 | |
231 | S-palmitoylation | RLLRSDFCPEHVPKK HHHCCCCCCCCCCHH | 4.67 | 21044946 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TLCD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TLCD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TLCD1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TLCD1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...