UniProt ID | TIRR_MOUSE | |
---|---|---|
UniProt AC | Q8VHN8 | |
Protein Name | Tudor-interacting repair regulator protein {ECO:0000250|UniProtKB:Q9BRJ7} | |
Gene Name | Nudt16l1 {ECO:0000312|MGI:MGI:1914161} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 211 | |
Subcellular Localization | Nucleus . | |
Protein Description | Key regulator of TP53BP1 required to stabilize TP53BP1 and regulate its recruitment to chromatin. In absence of DNA damage, interacts with the tandem Tudor-like domain of TP53BP1, masking the region that binds histone H4 dimethylated at 'Lys-20' (H4K20me2), thereby preventing TP53BP1 recruitment to chromatin and maintaining TP53BP1 localization to the nucleus. Following DNA damage, ATM-induced phosphorylation of TP53BP1 and subsequent recruitment of RIF1 leads to dissociate NUDT16L1/TIRR from TP53BP1, unmasking the tandem Tudor-like domain and allowing recruitment of TP53BP1 to DNA double strand breaks (DSBs). Binds U8 snoRNA.. | |
Protein Sequence | MSTTTVPELKQISREEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGGLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKYQLLFALKVLNMMPSEKLAEALASATEKQKKALEKLLPPSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSTTTVPEL ------CCCCCHHHH | 23737553 | ||
3 | Phosphorylation | -----MSTTTVPELK -----CCCCCHHHHH | 23737553 | ||
4 | Phosphorylation | ----MSTTTVPELKQ ----CCCCCHHHHHH | 23737553 | ||
5 | Phosphorylation | ---MSTTTVPELKQI ---CCCCCHHHHHHH | 23737553 | ||
13 | Phosphorylation | VPELKQISREEAMRL HHHHHHHCHHHHHHH | 23737553 | ||
151 | Ubiquitination | RVPLYTQKDRVGGFP EEEECCCCCCCCCCC | 22790023 | ||
151 (in isoform 2) | Ubiquitination | - | 22790023 | ||
162 | Phosphorylation | GGFPNFLSNAFVSTA CCCCCHHHHHHHHHH | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIRR_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIRR_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIRR_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TIRR_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...