dbPTM

TIPE_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TIPE_DROME
UniProt AC	P48613
Protein Name	Protein tipE
Gene Name	tipE
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	452
Subcellular Localization	Membrane Multi-pass membrane protein.
Protein Description	Enhances para sodium channel function. Required during pupal development to rescue adult paralysis and also protects adult flies against heat-induced lethality..
Protein Sequence	MGDEQDKRTGKEKLLFYTTAFFILLGTFSLFAFLFLVPFVIEPAFTTIFMQFEEVPALCETYDTEIYYGAKNCSWSSCREGCTKDIYTCTQIRVNYRLNLYNFTDEFNFTEYHINLKEAERILPPVKRTDRYERALRSDYEYDNLGGGTGLDIDLGAGRMEQLNFGDADGSNGYLIEDSEDTRGLSASGTLISDERRPFDEISELNEGLMGNRSMYYYVGARLFPNVKGCGYPPMLNCTIWLKRYTKIGMKFPCYYSKVDPSLVISDLDYWQNTLNLVYSMAIPIPSFIISVIYLTYAYFKIYNEDEETAPLDKNAEDMDIDDIDAVDDSDGAVLADNVAGSQIINMDSTTNDSCLEGVLPNGGPGMTASISQGGSVTTPGPYIAQSPAGSQMTPNSEINSFGHQLKVQMADELSRDSLENGAISTSNSVQGNLSKTMTTSISTPPGPTAAV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
72	N-linked_Glycosylation	EIYYGAKNCSWSSCR EEEEECCCCCHHHCC	25.23	-
102	N-linked_Glycosylation	NYRLNLYNFTDEFNF EEEECCCCCCCCCCC	36.19	-
108	N-linked_Glycosylation	YNFTDEFNFTEYHIN CCCCCCCCCEEEEEC	40.66	-
212	N-linked_Glycosylation	LNEGLMGNRSMYYYV HHHHHCCCCCHHEEE	20.91	-
237	N-linked_Glycosylation	CGYPPMLNCTIWLKR CCCCCCCCEEEEHHH	18.03	-
418	Phosphorylation	ADELSRDSLENGAIS CHHHCHHHHHCCCCC	36.15	27794539
429	Phosphorylation	GAISTSNSVQGNLSK CCCCCCCCCCCCCCC	18.65	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TIPE_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TIPE_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TIPE_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TIPE_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TIPE_DROME

Related Literatures of Post-Translational Modification