UniProt ID | TIM8B_MOUSE | |
---|---|---|
UniProt AC | P62077 | |
Protein Name | Mitochondrial import inner membrane translocase subunit Tim8 B | |
Gene Name | Timm8b | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 83 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side. |
|
Protein Description | Probable mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).. | |
Protein Sequence | MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGSRLDSRTENCLSSCVDRFIDTTLAITGRFAQIVQKGGQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM8B_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM8B_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM8B_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TIM8B_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...