| UniProt ID | TIM50_MOUSE | |
|---|---|---|
| UniProt AC | Q9D880 | |
| Protein Name | Mitochondrial import inner membrane translocase subunit TIM50 | |
| Gene Name | Timm50 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 353 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
| Protein Description | Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Has some phosphatase activity in vitro; however such activity may not be relevant in vivo.. | |
| Protein Sequence | MAASAALFSRLRSGLRVGARGLCTRLAPPPPRTPEQVTEIANRGGSKAQGPQHQPGSEGPSYAKKIALWIAGLLGAGGTVSIVYIFGNNPVDENGTKIPDEFDSDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLREPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMEGHHVKDISCLNRDPARVVVVDCKKEAFRLQPFNGVALRPWDGNSDDRVLLDLSAFLKTIALNQVEDVRTVLEHYALEDDPLEAFKQRQSRLEQEEQQRLAELSKSNRQGLSFGSLASRLWPRSKQP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 33 | Phosphorylation | LAPPPPRTPEQVTEI CCCCCCCCHHHHHHH | 36.63 | 23684622 | |
| 38 | Phosphorylation | PRTPEQVTEIANRGG CCCHHHHHHHHHCCC | 22.74 | 23684622 | |
| 249 | S-nitrosocysteine | ARVVVVDCKKEAFRL CEEEEEECCCHHEEC | 4.60 | - | |
| 249 | S-nitrosylation | ARVVVVDCKKEAFRL CEEEEEECCCHHEEC | 4.60 | 21278135 | |
| 338 | Phosphorylation | KSNRQGLSFGSLASR HHHHCCCCHHHHHHH | 34.09 | 28066266 | |
| 341 | Phosphorylation | RQGLSFGSLASRLWP HCCCCHHHHHHHHCC | 20.82 | 28066266 | |
| 344 | Phosphorylation | LSFGSLASRLWPRSK CCHHHHHHHHCCCCC | 32.95 | 28066266 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM50_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM50_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM50_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TIM50_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
