UniProt ID | TIM13_MOUSE | |
---|---|---|
UniProt AC | P62075 | |
Protein Name | Mitochondrial import inner membrane translocase subunit Tim13 | |
Gene Name | Timm13 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 95 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side. |
|
Protein Description | Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins (By similarity).. | |
Protein Sequence | MDSGFGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDSGFGSD -------CCCCCCCC | 9.26 | - | |
3 | Phosphorylation | -----MDSGFGSDFG -----CCCCCCCCCC | 34.42 | 26643407 | |
7 | Phosphorylation | -MDSGFGSDFGGTGG -CCCCCCCCCCCCCC | 27.75 | 26643407 | |
12 | Phosphorylation | FGSDFGGTGGGKLDP CCCCCCCCCCCCCCH | 32.79 | 26643407 | |
49 | Malonylation | MTDKCFRKCIGKPGG HHHHHHHHHHCCCCC | 15.22 | 26320211 | |
53 | Succinylation | CFRKCIGKPGGSLDN HHHHHHCCCCCCCCC | 22.15 | - | |
53 | Acetylation | CFRKCIGKPGGSLDN HHHHHHCCCCCCCCC | 22.15 | 23806337 | |
53 | Succinylation | CFRKCIGKPGGSLDN HHHHHHCCCCCCCCC | 22.15 | 23806337 | |
57 | Phosphorylation | CIGKPGGSLDNSEQK HHCCCCCCCCCHHHH | 38.16 | - | |
61 | Phosphorylation | PGGSLDNSEQKCIAM CCCCCCCHHHHHHHH | 40.86 | 23140645 | |
64 | Acetylation | SLDNSEQKCIAMCMD CCCCHHHHHHHHHHH | 24.45 | 23864654 | |
64 | Malonylation | SLDNSEQKCIAMCMD CCCCHHHHHHHHHHH | 24.45 | 26073543 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM13_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM13_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM13_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TIM13_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...