TIM10_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TIM10_DROME
• UniProt AC: Q9W2D6
• Protein Name: Mitochondrial import inner membrane translocase subunit Tim10
• Gene Name: Tim10
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 92
• Subcellular Localization: Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.
• Protein Description: Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity)..
• Protein Sequence: MALPQISTADQAKLQLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESELGKGEMVCIDRCVAKYLDIHEKIGKKLTAMSMQDEELMKKMSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TIM10_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TIM10_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TIM10_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TIM10_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.