TIM10_DROME - dbPTM
TIM10_DROME - PTM Information in dbPTM
Basic Information of Protein
UniProt ID TIM10_DROME
UniProt AC Q9W2D6
Protein Name Mitochondrial import inner membrane translocase subunit Tim10
Gene Name Tim10
Organism Drosophila melanogaster (Fruit fly).
Sequence Length 92
Subcellular Localization Mitochondrion inner membrane
Peripheral membrane protein
Intermembrane side.
Protein Description Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity)..
Protein Sequence MALPQISTADQAKLQLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESELGKGEMVCIDRCVAKYLDIHEKIGKKLTAMSMQDEELMKKMSS
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of TIM10_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of TIM10_DROME !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of TIM10_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of TIM10_DROME !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of TIM10_DROME

loading...

Related Literatures of Post-Translational Modification

TOP