TI17B_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TI17B_MOUSE
• UniProt AC: Q9Z0V7
• Protein Name: Mitochondrial import inner membrane translocase subunit Tim17-B
• Gene Name: Timm17b
• Organism: Mus musculus (Mouse).
• Sequence Length: 172
• Subcellular Localization: Mitochondrion inner membrane; Multi-pass membrane protein.
• Protein Description: Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane..
• Protein Sequence: MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRFRGSVNAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSISSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLTPKEGSPAPGYPNYQQYH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
152	Phosphorylation	PPFLEDPSQLTPKEG CCCCCCHHHCCCCCC	50.58	28066266
155	Phosphorylation	LEDPSQLTPKEGSPA CCCHHHCCCCCCCCC	25.36	26060331
160	Phosphorylation	QLTPKEGSPAPGYPN HCCCCCCCCCCCCCC	20.98	23684622

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TI17B_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TI17B_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TI17B_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of TI17B_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.