| UniProt ID | THY1_RAT | |
|---|---|---|
| UniProt AC | P01830 | |
| Protein Name | Thy-1 membrane glycoprotein | |
| Gene Name | Thy1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 161 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. |
|
| Protein Description | May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.. | |
| Protein Sequence | MNPVISITLLLSVLQMSRGQRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKCGGISLLVQNTSWLLLLLLSLSFLQATDFISL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 20 | Pyrrolidone_carboxylic_acid | VLQMSRGQRVISLTA HHHCCCCCCEEEEEE | 35.04 | - | |
| 20 | Pyrrolidone_carboxylic_acid | VLQMSRGQRVISLTA HHHCCCCCCEEEEEE | 35.04 | 6118137 | |
| 20 | Pyrrolidone_carboxylic_acid | VLQMSRGQRVISLTA HHHCCCCCCEEEEEE | 35.04 | 6118137 | |
| 42 | N-linked_Glycosylation | RLDCRHENNTNLPIQ CCEEECCCCCCCCEE | 55.27 | 6118137 | |
| 59 | Acetylation | FSLTREKKKHVLSGT EECCHHHHHHEEECC | 43.27 | 22902405 | |
| 74 | Phosphorylation | LGVPEHTYRSRVNLF CCCCCCCHHHHCCCC | 14.43 | - | |
| 82 | Phosphorylation | RSRVNLFSDRFIKVL HHHCCCCCHHHHHHE | 30.92 | 25403869 | |
| 93 | N-linked_Glycosylation | IKVLTLANFTTKDEG HHHEEECCCCCCCCC | 37.60 | 6118137 | |
| 117 | N-linked_Glycosylation | GQNPTSSNKTINVIR CCCCCCCCCEEEEHH | 45.30 | 6118137 | |
| 130 | GPI-anchor amidated cysteine | IRDKLVKCGGISLLV HHHHHEECCCCHHHH | 4.74 | - | |
| 130 | GPI-anchor | IRDKLVKCGGISLLV HHHHHEECCCCHHHH | 4.74 | 2897081 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THY1_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THY1_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THY1_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of THY1_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| GPI-anchor | |
| Reference | PubMed |
| "Complete structure of the glycosyl phosphatidylinositol membraneanchor of rat brain Thy-1 glycoprotein."; Homans S.W., Ferguson M.A., Dwek R.A., Rademacher T.W., Anand R.,Williams A.F.; Nature 333:269-272(1988). Cited for: STRUCTURE OF THE GPI-ANCHOR AT CYS-130. | |
| N-linked Glycosylation | |
| Reference | PubMed |
| "Rat brain Thy-1 glycoprotein. The amino acid sequence, disulphidebonds and an unusual hydrophobic region."; Campbell D.G., Gagnon J., Reid K.B.M., Williams A.F.; Biochem. J. 195:15-30(1981). Cited for: PROTEIN SEQUENCE OF 20-130, GLYCOSYLATION AT ASN-42; ASN-93 ANDASN-117, AND DISULFIDE BONDS. | |
