UniProt ID | THY1_CHICK | |
---|---|---|
UniProt AC | Q07212 | |
Protein Name | Thy-1 membrane glycoprotein | |
Gene Name | THY1 | |
Organism | Gallus gallus (Chicken). | |
Sequence Length | 160 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. |
|
Protein Description | May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.. | |
Protein Sequence | MNPTVSIAVILTVLQAAHCQMIRDLSACLLGQSLRVDCRYENKTSNPLTYEFSLTRQQKHIIQSTISVSENVYRNRANVTMHKNLVCLYLHSFTTSDEGVYMCELKATNDYTGNQIKNITVIKDKLEKCVRLSLLIQNTSWLLLLLLSLPLLQAVDFVSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Pyrrolidone_carboxylic_acid | VLQAAHCQMIRDLSA HHHHHHHHHHHHHHH | 22.07 | - | |
20 | Pyrrolidone_carboxylic_acid | VLQAAHCQMIRDLSA HHHHHHHHHHHHHHH | 22.07 | - | |
42 | N-linked_Glycosylation | RVDCRYENKTSNPLT EEEEEECCCCCCCCE | 43.93 | - | |
78 | N-linked_Glycosylation | NVYRNRANVTMHKNL HHHHCCCCCEEECCE | 26.93 | - | |
118 | N-linked_Glycosylation | YTGNQIKNITVIKDK CCCCEEEEEEEEHHH | 36.47 | - | |
129 | GPI-anchor | IKDKLEKCVRLSLLI EHHHHHHHHHHHHHH | 1.25 | - | |
138 | N-linked_Glycosylation | RLSLLIQNTSWLLLL HHHHHHHCHHHHHHH | 29.14 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THY1_CHICK !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THY1_CHICK !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THY1_CHICK !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of THY1_CHICK !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...