THY1_CHICK - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: THY1_CHICK
• UniProt AC: Q07212
• Protein Name: Thy-1 membrane glycoprotein
• Gene Name: THY1
• Organism: Gallus gallus (Chicken).
• Sequence Length: 160
• Subcellular Localization: Cell membrane; Lipid-anchor, GPI-anchor.
• Protein Description: May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain..
• Protein Sequence: MNPTVSIAVILTVLQAAHCQMIRDLSACLLGQSLRVDCRYENKTSNPLTYEFSLTRQQKHIIQSTISVSENVYRNRANVTMHKNLVCLYLHSFTTSDEGVYMCELKATNDYTGNQIKNITVIKDKLEKCVRLSLLIQNTSWLLLLLLSLPLLQAVDFVSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Pyrrolidone_carboxylic_acid	VLQAAHCQMIRDLSA HHHHHHHHHHHHHHH	22.07	-
20	Pyrrolidone_carboxylic_acid	VLQAAHCQMIRDLSA HHHHHHHHHHHHHHH	22.07	-
42	N-linked_Glycosylation	RVDCRYENKTSNPLT EEEEEECCCCCCCCE	43.93	-
78	N-linked_Glycosylation	NVYRNRANVTMHKNL HHHHCCCCCEEECCE	26.93	-
118	N-linked_Glycosylation	YTGNQIKNITVIKDK CCCCEEEEEEEEHHH	36.47	-
129	GPI-anchor	IKDKLEKCVRLSLLI EHHHHHHHHHHHHHH	1.25	-
138	N-linked_Glycosylation	RLSLLIQNTSWLLLL HHHHHHHCHHHHHHH	29.14	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of THY1_CHICK !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of THY1_CHICK !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of THY1_CHICK !!

Protein-Protein Interaction

Oops, there are no PPI records of THY1_CHICK !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.