dbPTM

THF1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	THF1_ARATH
UniProt AC	Q9SKT0
Protein Name	Protein THYLAKOID FORMATION 1, chloroplastic
Gene Name	THF1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	300
Subcellular Localization	Plastid, chloroplast outer membrane Single-pass membrane protein. Plastid, chloroplast stroma.
Protein Description	Involved in a dynamic process of vesicle-mediated thylakoid membrane biogenesis. Required for the normal organization of vesicles into mature thylakoid stacks and ultimately for leaf development. Also involved in a sugar-signaling mechanism in roots by mediating signaling between the plasma membrane and the plastid. Probably acts downstream of the plasma membrane-delimited heterotrimeric G-protein GPA1 in a D-glucose signaling pathway..
Protein Sequence	MAATAISSLSFPALGQSDKISNFASSRPLASAIRICTKFSRLSLNSRSTSKSLIHCMSNVTADVPPVSETKSKFLKAYKRPIPSIYNTVLQELIVQQHLMRYKKTYRYDPVFALGFVTVYDQLMEGYPSDQDRDAIFKAYIEALNEDPKQYRIDAQKMEEWARSQTSASLVDFSSKEGDIEAVLKDIAGRAGSKEGFSYSRFFAVGLFRLLELASATDPTVLDKLCASLNINKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKQGERAQSQKANETISKCLGDTLYNPSFLVERKS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Phosphorylation	ASAIRICTKFSRLSL HHHHHHHHHHHHCCC	32.52	29797451
50	Phosphorylation	SLNSRSTSKSLIHCM CCCCCCCCHHHHHHH	22.84	29797451
164	Phosphorylation	KMEEWARSQTSASLV HHHHHHHHCCCCHHH	30.02	25561503
166	Phosphorylation	EEWARSQTSASLVDF HHHHHHCCCCHHHCC	27.75	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of THF1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of THF1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of THF1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
OEP80_ARATH	OEP80	physical	16582010

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of THF1_ARATH

Related Literatures of Post-Translational Modification