| UniProt ID | THAP7_MOUSE | |
|---|---|---|
| UniProt AC | Q8VCZ3 | |
| Protein Name | THAP domain-containing protein 7 | |
| Gene Name | Thap7 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 309 | |
| Subcellular Localization | Nucleus. Chromosome. | |
| Protein Description | Chromatin-associated, histone tail-binding protein that represses transcription via recruitment of HDAC3 and nuclear hormone receptor corepressors.. | |
| Protein Sequence | MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPTSEYIYFCSKHFEENCFELVGISGYHRLKEGAVPTIFESFSKLRRTAKTKGHGYPPGLPDVSRLRRCRKRCSERQGPTTPFSPPPRADIICFPVEEASAPATLPASPAVRLDPGLNSPFSDLLGPLGAQADEAGCSTQPSPEQHPSPLEPQPASPSAYMLRLPPPAGAYIQNEHSYQVGSALLWKRRAEAALDALDKTQRQLQACKRREQRLRLRLTKLQQERAREKRAQADARQTLKDHVQDFAMQLSSSMA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 138 | Phosphorylation | QGPTTPFSPPPRADI CCCCCCCCCCCCCCE | 37.39 | 25159016 | |
| 158 | Phosphorylation | EEASAPATLPASPAV HHCCCCCCCCCCCCC | 32.01 | 20469934 | |
| 162 | Phosphorylation | APATLPASPAVRLDP CCCCCCCCCCCCCCC | 16.08 | 20469934 | |
| 210 | Phosphorylation | PLEPQPASPSAYMLR CCCCCCCCCCEEEEE | 26.52 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THAP7_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THAP7_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THAP7_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of THAP7_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...