UniProt ID | THAP7_MOUSE | |
---|---|---|
UniProt AC | Q8VCZ3 | |
Protein Name | THAP domain-containing protein 7 | |
Gene Name | Thap7 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 309 | |
Subcellular Localization | Nucleus. Chromosome. | |
Protein Description | Chromatin-associated, histone tail-binding protein that represses transcription via recruitment of HDAC3 and nuclear hormone receptor corepressors.. | |
Protein Sequence | MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPTSEYIYFCSKHFEENCFELVGISGYHRLKEGAVPTIFESFSKLRRTAKTKGHGYPPGLPDVSRLRRCRKRCSERQGPTTPFSPPPRADIICFPVEEASAPATLPASPAVRLDPGLNSPFSDLLGPLGAQADEAGCSTQPSPEQHPSPLEPQPASPSAYMLRLPPPAGAYIQNEHSYQVGSALLWKRRAEAALDALDKTQRQLQACKRREQRLRLRLTKLQQERAREKRAQADARQTLKDHVQDFAMQLSSSMA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
138 | Phosphorylation | QGPTTPFSPPPRADI CCCCCCCCCCCCCCE | 37.39 | 25159016 | |
158 | Phosphorylation | EEASAPATLPASPAV HHCCCCCCCCCCCCC | 32.01 | 20469934 | |
162 | Phosphorylation | APATLPASPAVRLDP CCCCCCCCCCCCCCC | 16.08 | 20469934 | |
210 | Phosphorylation | PLEPQPASPSAYMLR CCCCCCCCCCEEEEE | 26.52 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THAP7_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THAP7_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THAP7_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of THAP7_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...