UniProt ID | TEX36_HUMAN | |
---|---|---|
UniProt AC | Q5VZQ5 | |
Protein Name | Testis-expressed protein 36 | |
Gene Name | TEX36 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 186 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MTKGRRFNPPSDKDGRWFPHIGLTQKTPESITSATSKEPQSPHLPRQAEGKLPPIYKVREKQAVNNQFPFSVHDNRHSLENSGCYLDSGLGRKKISPDKRQHVSRNFNLWACDYVPSCLDGFSNNQISYVYKEAMVVSSFRRFPRCYKEIWNAFTFLPERSYTEVLKKKPKVRFTVDKKVVSSLES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Phosphorylation | HIGLTQKTPESITSA CCCCCCCCCCHHHHC | 25693802 | ||
30 | Phosphorylation | LTQKTPESITSATSK CCCCCCCHHHHCCCC | 25693802 | ||
32 | Phosphorylation | QKTPESITSATSKEP CCCCCHHHHCCCCCC | 25693802 | ||
33 | Phosphorylation | KTPESITSATSKEPQ CCCCHHHHCCCCCCC | 25693802 | ||
35 | Phosphorylation | PESITSATSKEPQSP CCHHHHCCCCCCCCC | 25693802 | ||
36 | Phosphorylation | ESITSATSKEPQSPH CHHHHCCCCCCCCCC | 25693802 | ||
41 | Phosphorylation | ATSKEPQSPHLPRQA CCCCCCCCCCCCCCC | 25693802 | ||
155 | Phosphorylation | KEIWNAFTFLPERSY HHHHHHHHHCCCCCH | 30622161 | ||
161 | Phosphorylation | FTFLPERSYTEVLKK HHHCCCCCHHHHHHC | 30622161 | ||
163 | Phosphorylation | FLPERSYTEVLKKKP HCCCCCHHHHHHCCC | 30622161 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TEX36_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TEX36_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TEX36_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TEX36_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...